KEGG   Blastococcus saxobsidens: BLASA_3993Help
Entry
BLASA_3993        CDS       T01752                                 

Gene name
psd
Definition
(GenBank) Phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00564  Glycerophospholipid metabolism
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
Module
bsd_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bsd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLASA_3993 (psd)
Enzymes [BR:bsd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BLASA_3993 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CCG04821
UniProt: H6RJ76
Position
3863247..3863912
Genome map
AA seq 221 aa AA seqDB search
MRIDPAGWPFITGPLAPAALLAAGGRATGRRWPRLAAWPLLGMSAYMALFFRDPDRRCDT
TPAGPDDVLSPADGVVMVAGEPQAGVAPEGDWQQVSVFLSVVDVHVNRSPYRGEVVESSY
RKGSFLAAYRKESAHRNERSELWLRDGERTVVFRQIVGVLARRIVTRTGPGQSLETGERM
GLMKFGSRMDVFVPPECTITVTKGQRVRGGETVIARWPSTN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgaccccgccgggtggcccttcatcaccggaccgctggcccctgccgccctg
ctcgctgcaggaggccgtgccacgggccgtcgttggcctcgcctggccgcctggcccctg
ctcggcatgtccgcctacatggcgctcttcttccgcgaccccgaccgccggtgcgacacc
accccggccggtcccgacgacgtcctgtcccccgccgacggtgtggtcatggtcgccggc
gagccgcaggcgggcgtcgcacccgagggcgactggcagcaggtcagcgtcttcctgtcg
gtggtcgacgtgcacgtcaaccgctccccctaccggggcgaggtcgtggagagctcctac
cgcaaggggagcttcctcgccgcgtaccgcaaggagtcggcgcaccggaacgagcgcagc
gagctgtggctgcgtgacggcgagcgcacggtcgtcttccggcagatcgtgggtgtgctg
gcgcggcggatcgtcacccgcaccggtcccggccagtcgctggagaccggtgagcggatg
gggctgatgaagttcggctcccgcatggacgtgttcgtgccgcccgagtgcacgatcacc
gtgacgaaggggcagcgcgtgcggggcggcgagaccgtcatcgcccgctggccctcgacc
aactga

DBGET integrated database retrieval system