KEGG   Blastococcus saxobsidens: BLASA_4193Help
Entry
BLASA_4193        CDS       T01752                                 

Gene name
deoA
Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00240  Pyrimidine metabolism
bsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BLASA_4193 (deoA)
Enzymes [BR:bsd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BLASA_4193 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C TMP_2 Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: CCG05019
UniProt: H6RLU0
Position
complement(4063811..4065082)
Genome map
AA seq 423 aa AA seqDB search
MDAIDVIRAKRDGATLTAEQIRWVIGAYTGGHVPDEQMSALLMAVFFRGMAADELAAWTQ
AMIDSGERKDLSSLGRPTADKHSTGGVGDKITLPLAPLVAACGVAVPQLSGRGLGHTGGT
LDKLEAIPGWRADVHEEAYLQQLRDVGAVICAAGNDLAPADKLLYALRDVTGTVESIPLI
ASSIMSKKIAEGADALVLDVKTGSGAFMKNTEDARTLARTMVGLGEAAGVRTVALVTAMD
RPLGRAAGNAVEVAESVEVLAGGGPADVVELTLALAREMLAGAGRDDVDPADALADGRAM
DVWRRMITAQGGDPDAPLPTPAERHVVTAPATGTLTRLDAFSLGVAAWRLGAGRARKEDP
VSAAAGVVWTAGVGERVTAGQPLLELQTDDPARIPRALEALEGAIGVDTDEQPLPLILDR
ITG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcgacgtcatccgcgcgaagcgggacggcgccacgctgacggccgagcag
atccgctgggtcatcggcgcctacaccggcggtcacgtccccgacgagcagatgagcgcg
ctgctcatggcggtcttcttccgcggcatggccgccgacgagctggccgcgtggacgcag
gcgatgatcgactccggcgagcgcaaggacctctcctcgctcggccggccgaccgcggac
aagcactcgaccggcggcgtcggcgacaagatcaccctgccgctcgcgccgctggtcgcg
gcctgcggcgtggcggtgccgcagctgtccgggcggggtctggggcacaccggcggcacg
ctggacaagctggaggccatccccggctggcgggccgacgtgcacgaggaggcctacctg
cagcagcttcgggacgtcggtgcggtgatctgcgcggcgggcaacgatctcgcgccggcg
gacaagctgctctacgcgctgcgcgacgtcaccggcaccgtcgagtcgatcccgctgatc
gccagctcgatcatgagcaagaagatcgccgagggcgccgacgccctggtgctggacgtg
aagaccggctccggcgccttcatgaagaacaccgaggacgcccgcaccctcgcccgcacg
atggtcggcctgggggaggccgccggtgtgcggacggtggcgctcgtgacggcgatggac
cggccgctgggccgggccgccggcaacgccgtggaggtcgccgagtcggtggaggtgctc
gccggtggtggtcccgccgacgtcgtcgagctcaccctcgcgctggcgcgggagatgctc
gccggcgccgggcgggacgacgtcgaccctgccgacgcgctggccgacggccgggcgatg
gacgtgtggcggcggatgatcaccgcccagggcggggacccggacgccccgctcccgacg
ccggccgagaggcacgtggtgacggcgccggcgaccggcacgctgacccggttggacgcg
ttctcgcttggcgtcgccgcctggcggctcggtgccggtcgcgcccgcaaggaggacccg
gtctcggccgcggccggcgtcgtctggaccgccggggtgggggagcgggtgaccgccggt
cagccgctgctggagctgcagacggacgacccagcacggatcccgcgggcactggaggcc
ctcgagggcgcgatcggcgtcgacacggacgagcagccgctgccgctgatcctggaccgc
atcaccggatga

DBGET integrated database retrieval system