KEGG   Bacillus selenitireducens: Bsel_0025Help
Entry
Bsel_0025         CDS       T01243                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bse  Bacillus selenitireducens
Pathway
bse03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bse00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bsel_0025
DNA repair and recombination proteins [BR:bse03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Bsel_0025
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bsel_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_8 HHH_5 IMS_HHH Transposase_20 Zn_ribbon_17
Motif
Other DBs
NCBI-ProteinID: ADH97576
UniProt: D6XV18
Position
34207..34803
Genome map
AA seq 198 aa AA seqDB search
MQYPQPVTKLIEGFMKLPGIGPKTAARLAFYVLDMNEDDVLDFAKALVNAKRELTYCSVC
HHITDTDPCRICDDQSRDRSIICVVQDAKDVIAMEKMREYTGMYHVLHGAISPVDGIGPE
DIFIPDLLKRLQDETVQELIIATNPNIEGEATAMYISRLVKPTGMKVTRIAHGLPVGGDL
EYADEMTLSRAIEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatatccgcaaccggtaacaaaactgatcgaaggatttatgaaactcccgggcatt
ggacccaaaacagctgcccgcctggctttttatgtgttggatatgaacgaggatgatgtg
ctcgattttgcaaaagcactggtgaatgcaaagcgtgaactgacttactgctcggtttgt
caccatatcaccgataccgatccgtgcagaatttgtgatgatcagagccgggaccgttcc
attatttgtgtcgtacaggatgcgaaggatgtcattgcaatggagaaaatgcgcgagtat
acaggaatgtatcatgtgcttcacggggcgatttcaccggttgacgggatcggaccggag
gatattttcatccctgatcttctgaaacggctgcaggacgaaacagttcaggaattaatc
atcgcaacgaatccgaatattgaaggggaagcgactgccatgtatatttcccgcctcgtc
aaaccgacgggaatgaaagtgacccggattgctcatggccttcctgttggcggcgatctt
gaatatgcagatgaaatgacactctcaagggcaatcgaaggaagacgggaactgtaa

DBGET integrated database retrieval system