KEGG   Bacillus selenitireducens: Bsel_0120Help
Entry
Bsel_0120         CDS       T01243                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bse  Bacillus selenitireducens
Pathway
bse03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bse00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Bsel_0120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bse03011]
    Bsel_0120
Ribosome [BR:bse03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Bsel_0120
  Bacteria
    Bsel_0120
  Archaea
    Bsel_0120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADH97669
UniProt: D6XVP6
Position
142259..142600
Genome map
AA seq 113 aa AA seqDB search
MEAKAVAKQVRIAPRKVRLVIDLIRGKEVGEAISILNHTPKKASPVVEKLLNSAIANAEH
NYEMEPDNLVVSQAFVDEGVTLKRFRPRAQGRASRINKRTSHITLVLTEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcagttgcaaaacaagtgcgtattgctcctcgaaaagttcgcctggtc
attgatttgatccgtggcaaagaggttggtgaagccatctccatcctgaaccacacaccg
aagaaagcatctccggttgtcgagaagcttctgaattccgccattgcgaacgcagagcac
aattatgaaatggaacctgacaatctcgttgtcagtcaagcatttgtagatgaaggtgtt
acactcaagcgtttccgtccacgtgcacagggacgtgcgagccgaatcaacaaacgtacg
agccatattacgctcgttcttacagaaaagaaggagggataa

DBGET integrated database retrieval system