KEGG   Bacillus selenitireducens: Bsel_0530Help
Entry
Bsel_0530         CDS       T01243                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bse  Bacillus selenitireducens
Pathway
bse00473  D-Alanine metabolism
bse01100  Metabolic pathways
bse01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bsel_0530
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Bsel_0530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bse01011]
    Bsel_0530
Enzymes [BR:bse01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Bsel_0530
Peptidoglycan biosynthesis and degradation proteins [BR:bse01011]
 Precursor biosynthesis
  Racemase
   Bsel_0530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADH98066
UniProt: D6XXZ3
Position
563205..564422
Genome map
AA seq 405 aa AA seqDB search
MKQIQEIYRKAGDQAVDVTHPFYRDTWAEIDLNAIHDNVTAIKASLPAHTEMMAVVKANA
YGHGAVDVAREALDAGATYLGVAILDEAIALRKAGIGAPILVLGYIRAEDILIASELDIA
VTVFQKDWLEKAESLLRAAGRKAVCHVKLDSGMGRIGLRKEEEIRELAEVLKASLHIHVE
GAYTHMAAADEPGNDYYHVQKERFLDMMDWLESSLGEKVKIRHCANSASALRFHEESCNL
VRVGISMYGMAPSVEMKPDMKVPLKQAMSLKSRITQVKLLEPGEGISYGSTYRTSGHEWI
GTVPIGYADGWIRAHQSGDVLVKGKRAKIVGRICMDQMMILLDGPVETGTEVTLIGEDGG
SFLSMDEVAGRIDTISYEIPCTLSYRVPRAVRKDGRVLYVHNDIF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatacaggagatatacaggaaagcgggggatcaggcggtggatgtgacacac
cctttttacagagatacatgggcggagatcgatttgaacgccattcatgataatgtgaca
gccataaaggcgtcgctgccggcgcatacggaaatgatggctgtcgtgaaggccaatgca
tacgggcacggggccgtcgatgtggcaagggaagcactcgatgctggtgcgacctacctc
ggtgtggcgatactcgatgaagccatcgccctcagaaaagcgggcatcggagcaccgatt
ctcgtattggggtatattcgggccgaggatattctcattgcctccgagcttgatatcgcc
gtgaccgtttttcaaaaagactggctggaaaaagccgagtcgcttctcagggcggccgga
agaaaagcggtatgccatgtgaaactcgattcaggcatggggcgcatcggacttcgaaaa
gaagaggagatccgcgaacttgcggaagttctgaaagcgtcccttcatatccatgtggaa
ggcgcatatacgcacatggcggcggctgatgagccggggaatgactattaccatgtgcaa
aaagaacgcttcctggacatgatggactggctggagtcctcactcggggagaaagtgaag
atccgccactgtgcgaacagtgcgtcggcgcttcgtttccacgaggaaagctgtaacctg
gtccgtgtcggcatttccatgtacggcatggcgccgtcggtcgagatgaaaccggatatg
aaggtgccactgaagcaggcgatgtccttaaagagcagaattacacaagtgaagctgctt
gaacctggcgaagggatcagctatggctccacctaccgcacaagcgggcatgaatggatc
gggacggtgccgatcgggtatgccgacggctggatccgggctcaccagtccggcgatgtc
ctcgtgaaggggaaacgggcgaaaattgtcgggcgaatctgtatggatcagatgatgatc
cttctcgacggtcccgttgagaccggtacggaggtgacgctgatcggtgaagatggggga
agttttctctccatggatgaagtggcaggcaggattgatacgatcagttatgagattccc
tgtaccctcagttaccgggttccccgggctgtccgtaaggacgggcgagtgctctatgtc
cataatgatattttctga

DBGET integrated database retrieval system