KEGG   Bacillus selenitireducens: Bsel_0599Help
Entry
Bsel_0599         CDS       T01243                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bse  Bacillus selenitireducens
Pathway
bse00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bsel_0599
Enzymes [BR:bse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bsel_0599
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bsel_0599
    1.1.1.-  
     Bsel_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ADH98135
UniProt: D6XY62
Position
complement(641644..642693)
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYKAKDLRVEDVPEPGIKGDHDVKVKVSCCGICGSDLHEYAAGPIFIPKDTPHPI
SGEKAPIIMGHEFSGEVVEVGPNVTRVKPGDMVAIEPILAPSENGRYTDAKYNLSPLLGF
HGLSGGGGGFSEFTVLGEHMVHKIPDGLSAEQGALVEPAAVALHAIRQSSLKAGDTACVF
GTGPIGLMVIDALKAAGASTIYAVEVSEARIKKAGDLGAVVINPKTEDAVAKIHELSGGG
VDVAFEVTGIPAVLNQCLHSTHTGGEAVIVSIWEQEASFQPNDLVIAERTMKGIIAYRHI
YPQVMELMKQGYFSGDKMITSRIGLDDVVDKGFDLLLSDKSQVKIIVTP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtctggtacaaagcgaaagatttacgggtagaagacgttcctgagccg
ggaatcaaaggggatcacgacgtgaaggtcaaagtcagctgttgcggaatttgcggaagc
gacctccatgaatacgccgcaggaccgatctttatccctaaagacacccctcatccgatc
agtggcgaaaaagcgccgatcatcatggggcacgaattttcaggtgaagtcgttgaggtt
ggcccgaatgtcacccgcgtgaaacccggtgacatggttgccatcgaaccgattcttgcc
ccttctgagaacggacgctataccgatgccaagtacaatctgtcgccgcttctcggcttt
cacggactgtccgggggcggaggcggattctccgagttcacggtcctcggcgagcatatg
gtgcataaaatccctgacggcctgtccgccgaacagggggctctcgtggaacctgccgct
gttgctttgcatgcgatccgtcaaagcagtctgaaagcaggggacaccgcttgcgtattc
ggcacaggaccgatcggcctgatggtcatcgatgctttaaaggcagccggtgcatccacc
atttacgccgttgaagtctcagaagccaggattaaaaaggccggcgatctcggtgcagtc
gtcatcaatccgaaaacagaagatgccgtcgccaaaattcacgaattatccggcggcggg
gttgacgtggccttcgaagtgaccggcatacctgccgtactgaatcagtgtctccacagc
acacacacgggcggcgaagccgtcatcgtgagcatttgggagcaggaggcgtcgtttcag
ccgaacgacctcgtcatcgccgaacggacgatgaagggcatcatcgcctaccggcatatt
tatccgcaggtgatggagctgatgaaacaggggtatttctccggagacaagatgatcacc
tcgaggatcggcctcgacgacgttgttgacaaaggctttgacctccttctgagtgacaag
agccaggtcaagatcatcgtgacaccttga

DBGET integrated database retrieval system