KEGG   Bacillus selenitireducens: Bsel_0707Help
Entry
Bsel_0707         CDS       T01243                                 

Definition
(GenBank) Gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bse  Bacillus selenitireducens
Pathway
bse00430  Taurine and hypotaurine metabolism
bse00460  Cyanoamino acid metabolism
bse00480  Glutathione metabolism
bse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Bsel_0707
   00460 Cyanoamino acid metabolism
    Bsel_0707
   00480 Glutathione metabolism
    Bsel_0707
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bse01002]
    Bsel_0707
Enzymes [BR:bse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Bsel_0707
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Bsel_0707
Peptidases and inhibitors [BR:bse01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Bsel_0707
CD molecules [BR:bse04090]
 Proteins
  Bsel_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ADH98240
UniProt: D6XYT2
Position
775930..777555
Genome map
AA seq 541 aa AA seqDB search
MMNSDRPVSVQEGKYGMVSTASSQATEAAVRVLKEGGNAVDAAVAAAFCLGVSEPQASGI
GGQSMALVYLKEQDKMFALDGSSRAPFSLHPKKNPKKPIKFGLASSTVPSTVATLGYLQD
YYGALTLKDTLAPSIETARDGFPVTKLIADMIEKERDHLVKDPSIVKNYFHTKKAPLKEG
DLLVQPELAKTMERLAEEGWQDFYTGEIGDAIVRDMARRGGMITDVDMHQIPLPVEREIL
HSTYRGLDIYTYPPPGAGRVLVQILNTLEQFSPEDLDPDEPLGAVILALSFRFALNYRKR
MPMSPDHYLQTTTNLLVDKGYAEEIAKRIRGIYDRALSDTFIPPPTSGETTHLSVVDKGG
NACGITQSIELVFGSKTMAKDLGFFYNNYMSAFEYKDPAHPYYLLPGGRPWSSVAPLLIF
EKKKPRYLLGSPGSARISTALAQVITRLVDKGESLEDAIAAPRFHASEEGDLLIEKRRFK
EETLTALELAGFEMKKRGAYSFYLGCVQGVQLPIRWREPFVGVADPRRDGTAEGPDTIKQ
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacagtgatcgtcccgtttccgttcaggaagggaaatacggcatggtttccacc
gcgtcgtcccaggcgacagaagccgccgtccgtgtattgaaagaaggagggaacgccgtg
gatgcggcggttgccgcagccttttgtcttggcgtatccgaaccgcaggcgtccggcatc
ggcggtcagtccatggctctcgtctatctgaaggagcaggataaaatgtttgcccttgac
ggctcgtcccgggcgccgttttccctccatccgaagaaaaatccgaagaaaccgattaaa
ttcggcctggcatcgtccaccgtgccgtccaccgtggccacccttggctatttgcaggat
tactacggggcactgaccctgaaggataccctggccccgtcgattgaaacggcgcgggac
gggttcccggtgacgaagctcattgcggatatgatcgaaaaagaacgggatcaccttgtc
aaagacccgtctatcgtaaagaactatttccatacgaaaaaagccccgcttaaggaaggg
gaccttctcgtgcagcctgagcttgccaagacgatggagcgcctcgccgaagagggctgg
caggacttctatacaggagagatcggagacgcgatcgtccgggacatggccaggcgcggc
gggatgatcaccgacgtcgacatgcatcagattccgctgccggtcgagcgggaaatcctt
cacagcacgtaccgcggcctcgatatttatacgtatccgccgccaggggccggacgggtg
cttgtgcagatcctcaacacccttgaacagttttcaccagaagacctcgatccggatgaa
cctctcggtgccgtcattctcgccctctccttccgctttgctttgaactaccggaagcgg
atgccgatgagcccggatcattatttgcagacgacaaccaatctcctcgtggacaaaggc
tacgccgaagagattgccaagcggatccggggcatttacgaccgggccctctcggacacc
ttcattccgccgccgacgtcaggggagacgacgcatttgtccgtcgttgacaaaggcggc
aacgcctgcggcatcacccagtccattgaactcgtgttcggaagcaagacgatggccaaa
gatctcggtttcttctataacaactacatgagcgcctttgaatacaaggatcccgctcat
ccgtattatctcctcccgggcggacgtccttggagcagtgtggcgccgcttttgatcttt
gagaagaagaagccccgctacctcctcgggagtcccgggagtgcaagaatctccacggcc
cttgcccaggtgattacccggctcgtcgacaaaggggaaagccttgaagacgccattgcc
gcaccgcgttttcacgcgtcggaagaaggggatctcttaattgaaaaacgccggttcaaa
gaggaaaccctcacggcccttgagctggccggctttgaaatgaaaaaacggggagcatac
agcttttatctcggctgtgtgcaaggcgttcaacttccaatccggtggcgcgagccgttc
gtcggtgtcgccgatcccagacgggacggcacagccgaaggaccggatactataaaacag
gggtga

DBGET integrated database retrieval system