KEGG   Bacillus selenitireducens: Bsel_0912
Entry
Bsel_0912         CDS       T01243                                 

Definition
(GenBank) periplasmic binding protein/LacI transcriptional regulator
  KO
K10439  ribose transport system substrate-binding protein
Organism
bse  Bacillus selenitireducens
Pathway
bse02010  ABC transporters
bse02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bsel_0912
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Bsel_0912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bse02000]
    Bsel_0912
Transporters [BR:bse02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Bsel_0912
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6 PucR ATPgrasp_N SBP_bac_11 ANF_receptor
Other DBs
NCBI-ProteinID: ADH98435
UniProt: D6XZR1
Position
1039120..1040070
AA seq 316 aa
MRKGDGNMKNVLAVVMMLVLGMVAMACSTESPVNDGGNNAGGNDGGDGEITVGFSISTLN
NPFFVTLQEGAEAHAEELGIELLMVDAQDDDAKQINDVEDLITQGVDVILINPTDSTSVV
AAVEAANSAGIPVITVDRGADGGDVVAHIASDNVAGGEMAGELLIELVGDGADVAELEGI
SGSSAARERGEGFNNVAADALNIVTAQTANFNRAEGLTVMENILQGNPDLTGVFAHNDEM
ALGALEAAESAGREDLIIVGFDATDDAVAAVEDGRLAGTVAQQPLLIGQYALDAALQVAN
GEEVEDFIPVDLELVR
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcgtaaaggggatggaaacatgaagaacgtattggcagtagtcatgatgttggtgttg
ggtatggttgccatggcatgttcgacagagagtccggtgaatgatggaggtaataacgct
ggaggtaacgacggcggtgatggtgaaataacggttggtttttcgatttccacgctgaat
aacccgttctttgtgacgcttcaggaaggcgcggaggcacatgcagaggagctcggtatt
gaactccttatggtcgacgcacaggacgatgacgccaaacagattaacgatgtggaagat
ttgattacacagggtgtggatgtcattttgatcaacccgacggattcgacatccgttgtg
gcagccgttgaagcagccaacagtgcaggtattccggtgattaccgtagaccgcggtgca
gatggcggcgatgttgtcgcgcatattgcatcagataacgtcgctggcggtgaaatggcc
ggtgaactgttgattgaacttgtcggagatggagctgacgtggcagagcttgaagggatc
tcagggtcgtccgcggcccgtgagcgcggtgaaggctttaacaatgtggcagcggatgct
ttgaatattgtaactgcgcagacagcgaactttaatcgtgctgaaggtttgacggtcatg
gagaacatccttcagggaaatccggatttgaccggtgtatttgcccacaatgatgagatg
gcactcggcgcacttgaagcggcggaatcagcaggaagagaagatctcattatagtcggt
tttgatgccacggatgatgcagttgcagccgtcgaggatggccgactggccggaaccgtt
gcccagcagccgctcctgattggtcagtatgcccttgatgcagcgcttcaggtggcaaac
ggtgaagaagtggaggactttattccggttgatctggaattggtcagataa

DBGET integrated database retrieval system