KEGG   Bacillus selenitireducens: Bsel_1253Help
Entry
Bsel_1253         CDS       T01243                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bse  Bacillus selenitireducens
Pathway
bse00500  Starch and sucrose metabolism
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bsel_1253
Enzymes [BR:bse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bsel_1253
Exosome [BR:bse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bsel_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ADH98765
UniProt: D6XSH9
Position
complement(1440999..1442939)
Genome map
AA seq 646 aa AA seqDB search
MHNMKWKISDEDTYLFHQGTHYQSYKLMGAKKMTIDGQTGYRFTVWAPNAKAVSVTGDFN
DWVHGSHPLEKLTDMGLWAGFFPDVEDGVTYKFSLEHPDGRRLLKADPYAQYAEVRPNTA
SVTWADPEYAWSDEDWYKQKKSTSSYSSPVNIYEVHLGTWRKKPGEVEDDALYSYRELAE
TLIPYVKELGYTHIELLPITEHPFDLSWGYQITGYFAPTSRFGSPEDFKYFVDQCHRHKI
GVLLDWVPGHFCRDEHGLRQFDGEACYEYQDINKADKPSWGTLTFDFGRPEVQSFLISNA
VYWLREFHLDGIRVDAVASMMYLNFDRPEDKPKLYNTYGGEENLEATAFLRKLNQTVFAY
EPDVLMMAEDSSDVPLVTAPVHDGGLGFNYKWNMGWMNDMLKYMEYDPLHRKHHHNHLTF
SFMYTYSENFILPLSHDEVVHGKKSLLNKMPGDQWQQFANFRLLLAYQMAHPGKKLLFMG
GELAMYSEWKDKEDLDWHLLDYPLHRGAHEYIRVLNHMYKNSPALYELDHDPAGFQWIDA
DNQDQSITSFIRRGKKPGDEYIIICNFTPVVHYDFKIGVPEPGVYKEVFNTDYEHFGGSN
QINDGDHFTFDEKWHGFDQHMKIMVPPLAVSIFQIKSTHNDEEESQ
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcataacatgaagtggaaaataagtgatgaggatacatatttattccatcaaggaacc
cattaccaaagttacaaactgatgggtgcaaagaaaatgaccattgacggacaaaccggt
taccgttttaccgtttgggcacccaatgcgaaggcggtctctgtaaccggtgacttcaac
gactgggtacacggcagtcacccactcgaaaaactgaccgatatggggctttgggcagga
ttcttcccggatgttgaagacggcgtcacctataaattcagtctcgagcaccccgatgga
cgacggctgttaaaagcagatccctatgcgcagtatgcagaggtccgtccgaacacagcg
tccgttacgtgggctgatccggaatacgcgtggtctgacgaagactggtacaaacaaaaa
aaatcgacttcttcatattcatctcctgtgaacatttatgaagtgcacctcggcacatgg
cgaaagaagccgggcgaagttgaagatgatgccctttattcctaccgcgaactcgcagag
acgctcatcccctatgtaaaagaactcgggtacacacacattgaactcttgccaataacc
gaacacccatttgatctttcgtggggctatcagattaccggctatttcgcaccgacaagc
cgctttggatcacctgaggactttaagtatttcgtggatcagtgtcaccggcataagatc
ggggtcctcctcgactgggttccaggtcacttctgccgcgatgaacatgggcttcgccag
tttgacggggaagcctgctatgagtaccaagacattaataaagcggataaaccctcatgg
gggacactcaccttcgacttcggtcgccctgaagtccagagttttctcatctccaacgcc
gtttactggctccgcgaatttcatcttgacggcatccgcgttgatgccgtggcaagcatg
atgtatctgaacttcgaccgtccggaagataaaccgaagctctataacacctacggcggc
gaagaaaacctggaggccacagccttcttgcgaaaactcaatcagaccgtcttcgcctat
gagccggacgtattgatgatggcggaagacagctccgatgtgccacttgtaacggcaccg
gtacatgacggcggtctcggattcaattacaaatggaatatgggctggatgaacgacatg
ctcaagtacatggaatatgacccgcttcaccgcaagcatcaccataaccacctgacattc
tcctttatgtatacgtactcggagaacttcatcttgccactctcccatgatgaggtcgta
cacggaaaaaagtctttactcaataaaatgccgggtgatcagtggcagcagtttgcgaac
ttccgcctgctcctcgcctatcagatggcccatccgggcaaaaagcttctctttatgggc
ggcgaacttgccatgtacagcgaatggaaggataaagaggatttggactggcacctgctc
gactatccgctccaccgcggcgctcatgagtatattcgcgtattgaatcatatgtataag
aactcgcccgctctctacgagctcgatcatgacccggcagggtttcagtggatcgacgca
gataaccaggatcagagtatcacatcgtttatccgtcgcgggaaaaagccgggtgatgaa
tacatcatcatctgcaacttcacaccggtcgtccactacgatttcaaaatcggcgtccct
gaacccggtgtctataaagaggtcttcaataccgattacgagcatttcggcggctcgaat
cagatcaacgatggcgatcattttactttcgatgaaaaatggcacggctttgatcagcac
atgaaaatcatggtaccacctttagccgtttccattttccaaataaaatccacacacaac
gatgaggaggaatcccaatga

DBGET integrated database retrieval system