KEGG   Bacillus selenitireducens: Bsel_1349Help
Entry
Bsel_1349         CDS       T01243                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bse  Bacillus selenitireducens
Pathway
bse00010  Glycolysis / Gluconeogenesis
bse00030  Pentose phosphate pathway
bse00051  Fructose and mannose metabolism
bse00052  Galactose metabolism
bse00680  Methane metabolism
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01120  Microbial metabolism in diverse environments
bse01130  Biosynthesis of antibiotics
bse01200  Carbon metabolism
bse01230  Biosynthesis of amino acids
bse03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_1349
   00030 Pentose phosphate pathway
    Bsel_1349
   00051 Fructose and mannose metabolism
    Bsel_1349
   00052 Galactose metabolism
    Bsel_1349
  Energy metabolism
   00680 Methane metabolism
    Bsel_1349
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Bsel_1349
Enzymes [BR:bse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bsel_1349
Protein phosphatases and associated proteins [BR:bse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bsel_1349
Messenger RNA biogenesis [BR:bse03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Bsel_1349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADH98861
UniProt: D6XSS5
Position
1543145..1544104
Genome map
AA seq 319 aa AA seqDB search
MKRIAVLTSGGDSPGMNAAIRAVVRKAIFHGVEVYGVYYGYQGLIDGDIKKLELGSVGDI
IHRGGTILYTARCPEFKEKEGQLKGIENLRNLGIEGLVVIGGDGSFQGAKKLTAHGFPAI
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRDAGDLALWA
GLADGAETIMVPEVNDKMEDIIARLKRGHERGKKHSIIVVAEGAGDGVEIGKQIQAETNY
ETRVTVLGHIQRGGSPTGRDRVLASRLGARAVELLLEGTGGQVVGIERNAIVHHDIDDAL
AKKPSFDYDIYELSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgccgttttaaccagtggtggagactcaccgggaatgaatgcagcgatt
cgggccgttgtccgaaaagcgatcttccatggtgttgaagtatatggcgtctattatggc
taccagggcctgattgatggcgatatcaagaagcttgaactcggctccgtcggtgatatt
attcaccgtggcggaacgatcctttacacagcccgctgtccggaatttaaagaaaaggaa
ggtcagcttaagggaattgaaaacttgcgtaatctcggcatcgaaggcctcgttgtgatt
ggcggagacggctctttccagggtgcaaagaaactgacggctcacggattcccggcgatt
ggtgtcccgggcacgatcgataacgacattccgggaacggatttcacgatcggatttgat
acagcgctaaatacggtcatcgatgcaattgacaaaatcagagacacggcgacttcccat
gaacgcacgtatgtggttgaagtgatgggccgtgacgcaggtgatcttgctttgtgggca
ggtcttgctgatggtgcagagacgatcatggtccctgaggtgaatgacaagatggaagac
atcatcgcccgactcaagcggggacatgaacgcgggaagaagcacagtattattgttgtt
gctgaaggcgccggtgatggtgtcgaaatcggtaaacagattcaggcagaaacaaattac
gagacgcgtgtaacggttcttggccatattcagcgcggcgggtctcctacagggcgcgac
cgggtgttggcaagccgactcggtgcccgtgctgttgaactgcttcttgaaggcacaggc
ggacaggttgtcggcattgaacgaaacgcgatcgttcatcatgatattgatgatgccctt
gcgaagaaaccatcgttcgactatgacatttatgaactatcaaaagaactatccatctga

DBGET integrated database retrieval system