KEGG   Bacillus selenitireducens: Bsel_1900Help
Entry
Bsel_1900         CDS       T01243                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
bse  Bacillus selenitireducens
Pathway
bse00010  Glycolysis / Gluconeogenesis
bse00020  Citrate cycle (TCA cycle)
bse00620  Pyruvate metabolism
bse00640  Propanoate metabolism
bse00650  Butanoate metabolism
bse00680  Methane metabolism
bse01100  Metabolic pathways
bse01120  Microbial metabolism in diverse environments
bse01130  Biosynthesis of antibiotics
bse01200  Carbon metabolism
Module
bse_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_1900
   00020 Citrate cycle (TCA cycle)
    Bsel_1900
   00620 Pyruvate metabolism
    Bsel_1900
   00640 Propanoate metabolism
    Bsel_1900
   00650 Butanoate metabolism
    Bsel_1900
  Energy metabolism
   00680 Methane metabolism
    Bsel_1900
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Bsel_1900
Enzymes [BR:bse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Bsel_1900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_7 Fer4_10 Fer4 Fer4_2 Fer4_6 Fer4_16 Fer4_9 Fer4_21 Fer4_3 Fer4_4 Fer4_8 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ADH99404
UniProt: D6XUB8
Position
complement(2105788..2106801)
Genome map
AA seq 337 aa AA seqDB search
MSILPKKNELGFFEIRLESIGGLGANLAGKMLAEAGVQGLGLNGANFSSYGSEKKGSPVK
SFVRFCESDVEIRDHAPIEQPHVIGVFHEALYKMVDVVSGLTADGVVLVNTQSDFDTIRN
DLKVEYGTIAAVDALKIANEEKTKVNTAMLGALYRILDFLDPDYMRNVIRKTFEKKYPHL
VEPNIRTFDRGYNEVTFKKYEAPADAESREFTRVQPRLGYETQVMGGIITAQANSIQKDL
SGSRIGFLPEYKEESCIHCAACDTVCPDYCFVWEQGEDKKGRPQMFLKGIDYQYCKGCLK
CVDACPTDALADLVEEKGYAEDNQVKHNFPYVAGGMK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctattttaccaaaaaagaacgagcttggcttttttgagatccgactggaatccatc
ggcggacttggagccaaccttgcaggaaagatgctagctgaagcaggggttcagggattg
ggcctgaacggagccaacttctcctcttatggatcagagaagaaaggatctcctgttaaa
tcatttgtccggttttgtgaatcagatgttgaaattcgtgaccatgcaccaattgaacag
cctcatgttattggtgtattccatgaagcactttataaaatggtcgatgtcgtaagcggt
ttaacagcggacggggtagtccttgttaacacacagagcgattttgatacaatccgaaat
gatctgaaagtggaatatggcacgattgctgccgtcgatgctttaaaaatagccaatgaa
gaaaagacaaaagttaatacggcaatgctcggcgctctctatcgtatccttgatttcctg
gatcctgactatatgcgaaatgtcattcgcaaaacgtttgaaaagaaatacccacacctc
gttgaaccgaatatccgcacatttgaccgtggatacaatgaagtgacgtttaagaaatac
gaagcacctgccgatgcagagagcagagagtttacccgtgttcagccgcgactcggttat
gaaacacaggtgatgggtgggattatcaccgctcaggccaacagcattcaaaaagattta
agcggttcgcgtatcggctttctgcctgaatacaaagaagaatcctgtattcactgtgcc
gcctgtgacacagtctgcccggattattgctttgtctgggaacagggcgaagacaaaaaa
ggacgtccgcaaatgttccttaagggaattgattatcaatactgcaaaggctgtctgaaa
tgcgtggacgcttgtccgacagatgcacttgcagatcttgttgaagagaagggctatgca
gaagacaatcaggtgaaacacaactttccatacgttgcagggggtatgaaataa

DBGET integrated database retrieval system