KEGG   Bacillus selenitireducens: Bsel_2125Help
Entry
Bsel_2125         CDS       T01243                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
bse  Bacillus selenitireducens
Pathway
bse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01130  Biosynthesis of antibiotics
bse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bsel_2125
Enzymes [BR:bse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Bsel_2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N sCache_2 DUF3083
Motif
Other DBs
NCBI-ProteinID: ADH99629
UniProt: D6XUZ3
Position
complement(2356004..2357023)
Genome map
AA seq 339 aa AA seqDB search
MNKTLQKLMQKETLTEYEAQSFVEEMMNGMHNHETMAAVLSVIQFRGVTAEELAGFAKGM
QAKASNVTLDGKLLDTCGTGGDDQSTYNVSTAAAILVSSLGVHVAKHGNRSISSKTGSAD
VLEMLGIPFQRNQQEAKTALEAHQLSFFFAPDYHQAMKYVGPVRSALKMKTVFNLLGPLT
NPAGAQHRIIGVYGTEEARVMAEAASRMELEKVLFVSGHDGLDELTITGASTILEVQNGK
VTEYAFDPEDAGLKRGTLTSSVVETSEESAALIMRIFKNEAHEDATNLLLLNAGAALYAA
GEVSSIKEGVTKARGALGDQVLGHLERLKLRETSEKAAE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacgttacaaaagctcatgcaaaaagaaacgctcacagaatatgaggcgcaa
tcttttgtggaagagatgatgaacggcatgcataatcatgagaccatggcggcggttctt
tccgtcattcaattcagaggtgtcactgctgaggaacttgcagggtttgccaaaggcatg
caggcgaaggcgagtaacgtcactctcgatggtaagcttcttgatacgtgcggcacaggc
ggagacgatcagagcacgtataatgtttcgacagcagctgctattcttgtaagcagtctc
ggtgtccatgtggcgaagcacggaaaccgaagcatttcttcaaaaacagggagtgcagat
gtccttgaaatgctcggtattccctttcagcgaaatcaacaggaggcgaaaacagctctt
gaggctcatcaactgagtttcttttttgctcctgactaccatcaggcgatgaagtatgtc
ggacctgtaagatccgcattgaaaatgaaaacggtctttaatttgcttggtccacttaca
aaccccgccggagcacaacaccgaatcattggcgtctacgggacggaggaagcccgggtc
atggcagaagctgcaagccggatggagctcgaaaaggtgctgtttgtcagcggtcatgac
ggattggatgaactcaccataacgggtgcatcgaccattcttgaagtgcaaaacggtaaa
gtcacagagtacgcgtttgatcctgaagatgccgggttaaagaggggaacactgacgagc
tctgtggttgaaacctctgaagaaagtgccgcactgatcatgaggatctttaagaacgag
gctcatgaagatgccacaaatcttttattactgaatgcaggcgccgctctctatgctgcc
ggtgaagtttcaagcattaaagaaggcgttacaaaagcacggggtgcactgggagatcag
gtgcttgggcatcttgaaagattgaagctcagagagacttcggaaaaggcggctgaatga

DBGET integrated database retrieval system