KEGG   Bacillus selenitireducens: Bsel_2307Help
Entry
Bsel_2307         CDS       T01243                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bse  Bacillus selenitireducens
Pathway
bse00010  Glycolysis / Gluconeogenesis
bse00052  Galactose metabolism
bse00500  Starch and sucrose metabolism
bse00520  Amino sugar and nucleotide sugar metabolism
bse00521  Streptomycin biosynthesis
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01120  Microbial metabolism in diverse environments
bse01130  Biosynthesis of antibiotics
bse01200  Carbon metabolism
Module
bse_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_2307
   00052 Galactose metabolism
    Bsel_2307
   00500 Starch and sucrose metabolism
    Bsel_2307
   00520 Amino sugar and nucleotide sugar metabolism
    Bsel_2307
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bsel_2307
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bsel_2307
Enzymes [BR:bse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bsel_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA DUF1464
Motif
Other DBs
NCBI-ProteinID: ADH99810
UniProt: D6XW56
Position
complement(2527323..2528294)
Genome map
AA seq 323 aa AA seqDB search
MDHVFAGIDIGGTTVKIAFIQEDGSILDKWEIPTDKTEKGKHILRDIAASVNERKNTLDG
LTLKGAGVGAPGYIDVDHGVIVEAVNLGWKDYKVADILRDALEIPVFVDNDANLAAAGEK
WLGAGDNANNLLAVTLGTGVGGGILAGGEIIHGHAGLAGEIGHITSVKDDGAPCNCGKKG
CLETVSSATGIARLGTEAASEYPDSSLHAVIASKDKLEAKDVFAEAGKGDQAARKVVQES
MEHLGFALANLCNSFNPQVVVIGGGVSKAGKQLIDAIRPSFNRFAIPKIADETDMVIATL
GNDAGVIGGAWLARQKLTAAEAG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggatcatgtatttgcaggaattgatattggtggtacaaccgtaaagatagcttttatt
caagaagatggatctattttggataaatgggaaataccgactgataaaaccgaaaaaggg
aaacatatccttagagatatcgctgcttctgtcaatgagcgtaagaacacgcttgacggt
ctcacattaaagggggcaggtgttggcgctccgggttatatcgatgtggatcacggtgtc
atcgttgaagccgtaaacttaggttggaaagactataaagtcgcagatatcctcagggat
gcgttggagataccggtttttgttgataatgatgccaatcttgctgcagcgggagaaaag
tggctgggggccggcgataacgccaacaatttacttgcagtaacacttggaacaggcgtt
ggaggcggaatactggcaggtggagaaatcattcacggtcatgcaggtttagccggggag
atcggtcatatcacatctgtgaaagatgacggggcgccttgtaactgcgggaagaaaggc
tgcctcgaaacggtatcatctgcaacaggtattgccagactgggtacagaagcggcttcg
gagtatcctgattcatcattgcatgcggttattgcttcgaaggataagctggaggcaaaa
gacgtttttgcagaagcggggaaaggcgatcaggctgcaagaaaagtggttcaagaatcg
atggaacacctgggatttgcactggcaaatctttgtaattccttcaatcctcaggttgtt
gtgattggcggcggagtatccaaagcgggcaaacagctgattgatgcgattcgtccgtct
tttaaccgttttgctattcctaaaattgcggacgaaaccgatatggtgattgccactcta
ggcaacgatgcaggagtcataggcggggcgtggcttgcaagacaaaagctgactgctgct
gaagccgggtaa

DBGET integrated database retrieval system