KEGG   Bacillus selenitireducens: Bsel_3191Help
Entry
Bsel_3191         CDS       T01243                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bse  Bacillus selenitireducens
Pathway
bse00071  Fatty acid degradation
bse00280  Valine, leucine and isoleucine degradation
bse00310  Lysine degradation
bse00362  Benzoate degradation
bse00380  Tryptophan metabolism
bse00620  Pyruvate metabolism
bse00630  Glyoxylate and dicarboxylate metabolism
bse00640  Propanoate metabolism
bse00650  Butanoate metabolism
bse00900  Terpenoid backbone biosynthesis
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01120  Microbial metabolism in diverse environments
bse01130  Biosynthesis of antibiotics
bse01200  Carbon metabolism
bse01212  Fatty acid metabolism
bse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bsel_3191
   00630 Glyoxylate and dicarboxylate metabolism
    Bsel_3191
   00640 Propanoate metabolism
    Bsel_3191
   00650 Butanoate metabolism
    Bsel_3191
  Lipid metabolism
   00071 Fatty acid degradation
    Bsel_3191
   00072 Synthesis and degradation of ketone bodies
    Bsel_3191
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bsel_3191
   00310 Lysine degradation
    Bsel_3191
   00380 Tryptophan metabolism
    Bsel_3191
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bsel_3191
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bsel_3191
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bsel_3191
Enzymes [BR:bse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bsel_3191
Exosome [BR:bse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bsel_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADI00673
UniProt: D6Y0V5
Position
complement(3443803..3444984)
Genome map
AA seq 393 aa AA seqDB search
MTETVIISGARTPFGKLGGALSSMKAAELGGIALKETMKRGNTAPEDIDHVLMGTVLQGG
QGQLPSRQALHNAGIPWETETETINKVCASGMRSVTLADLLIRTGQYRTILAGGMESMSQ
APYFMKGARFGFRMGDQTLQDMMVHDGLTCTFRGVHMGNYGNQVADELQLDRESQDEWAL
RSHQRAGQAVKDGRFAEEIAPVAVPQRKGEPLIVSEDEAPRSDTTLERLKSLKPVFGKEG
TITAGNAPGVNDGACALLLMSKEDAVEKGHTPLAVIKGHTSLAVEPENFPKTPGLVIQKL
LDQTGKTVDDIDLFEINEAFAAVSLAGSKIAGLDNGKVNVNGGAVALGHPIGASGTRIIL
TLAHELKKRGGGTGIAAICSGGGQGDAIMIEVE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaaacggttattatcagcggggcacgaacgccgtttggcaaactcgggggcgcc
ctgtcatccatgaaagcggcagagctcggggggattgccctgaaagaaacgatgaagcgg
gggaatacggcaccggaagacatcgatcacgtcttgatgggcacggttcttcagggcgga
caggggcagctgccgtcgagacaggcgctgcacaacgcggggattccgtgggaaaccgaa
acagaaaccatcaataaagtctgtgcatcaggcatgcggagtgtcactctggctgatctg
ctgatccggacggggcagtaccgcaccattcttgccggaggcatggaatcgatgagtcag
gctccgtatttcatgaaaggtgcccgtttcgggtttcgcatgggcgatcagaccttacag
gacatgatggttcatgacggactcacgtgtacttttcgcggggttcacatggggaactac
ggcaatcaggtggctgatgaactgcagctcgaccgggagagccaggacgaatgggcactg
aggagccatcagcgtgccggacaggccgtgaaggatggccggttcgccgaagagatcgca
ccggttgccgtcccgcagcgaaagggagagcctttgattgtctcggaagacgaggcgccg
cgaagcgatacgactttagagaggctgaagtccctgaagccggtattcggaaaagagggc
acgatcactgccgggaacgctccgggtgtcaatgacggcgcctgcgcgcttcttctcatg
tcaaaggaagatgccgtggaaaagggccacacgccccttgccgtgatcaaaggacacacc
tccctcgccgtcgagccggagaatttcccgaagacgccgggccttgtcattcagaaactc
ctcgatcagacggggaaaaccgttgacgacatcgatctgtttgagatcaatgaagccttt
gccgcggtgtcactggccggcagtaaaatcgccggactcgataacgggaaagtcaacgtg
aacggcggtgccgtcgccctcggtcatccgatcggcgcaagcggtacgcggatcatcctc
actctcgcccatgaactgaagaaacgcggcggcggaacagggattgcggccatctgcagc
ggcggcggtcagggtgacgcaattatgatcgaagtggaataa

DBGET integrated database retrieval system