KEGG   Bradymonas sediminis: DN745_00540Help
Entry
DN745_00540       CDS       T05497                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
bsed  Bradymonas sediminis
Pathway
bsed00740  Riboflavin metabolism
bsed00790  Folate biosynthesis
bsed01100  Metabolic pathways
bsed01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    DN745_00540 (ribA)
   00790 Folate biosynthesis
    DN745_00540 (ribA)
Enzymes [BR:bsed01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     DN745_00540 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     DN745_00540 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AWV87893
UniProt: A0A2Z4FG46
Position
complement(158451..159110)
Genome map
AA seq 219 aa AA seqDB search
MPSHLTAPPLALTPSTRARLEAADGLLVEKFAEAALPTKHGDFRIVAFINNLDFKEHVAL
VRGDLAAQAIVPTRIHSECVTGDVFGSLKCDCGEQLEHAQKELGNSPAGVILYMRQEGRG
IGLANKIKAYSLQDQGMDTVEANLHLGFDDDLRDYTVAAEMLRLLGVDNISLITNNPRKA
EGLRANGITVTERQPLIILPNPHNKDYLDTKRDKSGHLL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcccagccaccttacggcgcccccgcttgcattaacccccagcacgcgcgcgagactc
gaagcggccgacggcctgctcgtcgagaaattcgccgaagccgccctgcctacaaaacat
ggggatttccgcatcgtcgccttcatcaacaaccttgatttcaaggagcatgtcgcgctg
gtgcgcggcgacctcgccgcccaggcgatcgtgccgacccgcatccacagcgaatgcgtc
accggcgatgtattcggcagcctgaaatgcgattgcggcgagcaactcgagcacgcgcaa
aaagagttgggaaactcgcctgccggcgtgatcctctatatgcgccaggaaggccgcggc
attggcctggccaacaagatcaaggcctatagcctgcaggaccagggcatggacaccgtc
gaggccaacctgcacctggggttcgacgacgacctgcgcgactataccgtggccgccgag
atgctgcgcctgctcggcgtcgacaatatctcactgatcaccaataacccgcgcaaggcc
gagggcctgcgcgccaacggcatcacggtcaccgagcgccagccgctgatcatcctgccc
aacccgcataacaaagattatctggacaccaaacgcgataaatcgggccatctcctctaa

DBGET integrated database retrieval system