KEGG   Bradymonas sediminis: DN745_01030Help
Entry
DN745_01030       CDS       T05497                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bsed  Bradymonas sediminis
Pathway
bsed03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DN745_01030 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsed03011]
    DN745_01030 (rplV)
Ribosome [BR:bsed03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DN745_01030 (rplV)
  Bacteria
    DN745_01030 (rplV)
  Archaea
    DN745_01030 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AWV87987
UniProt: A0A2Z4FGC2
Position
289484..289849
Genome map
AA seq 121 aa AA seqDB search
MGKNNLGCRANRASARNVRISAKKARPVIDLVRSKPIMEALDILQFTPRKAAPVIAKVIE
SAMHNVEQSEELDWDVDDLIVAQAFVDEGPTLRRFKPRAQGRATRINKRSSHITVVLELP
R
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaataatttaggatgccgggccaatagagcctcggcccgcaacgtgcgcatc
tcggcgaaaaaggcgcgcccagtcattgacttggttcgctccaagccgattatggaagcg
cttgatattctgcagttcacgccgcgcaaagctgcgccggtgatcgcgaaagtgatcgag
tcggccatgcacaacgtggagcagagcgaggagcttgattgggacgttgacgatctgatc
gtcgcccaagcatttgtcgacgagggtccgacgttgcgccgctttaagccgcgcgcacag
ggtcgcgccacgcgcatcaataaacgtagtagtcatatcaccgtggtgctcgagctgccg
cgctaa

DBGET integrated database retrieval system