KEGG   Bradymonas sediminis: DN745_03625Help
Entry
DN745_03625       CDS       T05497                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bsed  Bradymonas sediminis
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DN745_03625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AWV91342
UniProt: A0A2Z4FQZ3
Position
complement(970750..972024)
Genome map
AA seq 424 aa AA seqDB search
MALAFGFYMAWTIGANDAANAMGTSVGSGAITFKEAVIIAAVFEFSGAILAGSGVTDTMR
KGIIDPALFNQMPQGAEIFALGMLASLMAAAIWLHFAAFVGWPVSTTHSIVGAIAGFGVA
SVGMSNVDFGTLGIIVSSWVVSPVAGGLLAFLIFTAIRKTIIDTPNPVLSVKKWGPAFAF
PIFLVLALVLFTKGLKNVDLPLDTYGIAIISVLTGIIASTVLWWILRKIQTPTDVDRGEH
ETLRDVHHSRVERVFRYLQTITACFVAFAHGSNDVANAIGPLAGIVSLFDGTTFQGSDAL
GSAVPVPTWVLMIGGVGILVGLATYGYKVIETIGTKITDITPSRGFAAEFGAATTILIGS
KIGLPLSTTHTIVGAVIGVGFARGMNALNLQIIWQIAKAWVYTIPFTAVLTVVIFKVLQY
FFLV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgcctttggtttctatatggcgtggacgatcggggcaaacgacgcggcaaac
gcgatgggaaccagcgttggttccggtgccattaccttcaaagaagccgtcatcattgcg
gcggtctttgagttctctggcgcgattctagctggcagcggtgtcaccgacaccatgcga
aaagggatcatcgaccccgcgctctttaaccagatgccccagggcgcggagatcttcgcg
ctgggcatgttggcctcgcttatggcggccgcgatttggcttcatttcgcggcgtttgtt
ggctggccggtctcgacgacgcacagcatcgtcggcgccatcgccggtttcggtgtggcc
tccgtcggcatgtccaatgtcgacttcggcacccttggcatcatcgtgtcgagctgggtt
gtcagccccgtcgcgggtggcctgctggccttcctgatatttacggccatccgaaagacc
atcatcgataccccaaatccagttttatcggttaaaaaatggggcccggcctttgccttc
cccatcttcttggtgttggccctggtgctgtttaccaaggggctaaagaacgtcgacttg
ccgctcgatacctacggcatcgcgatcatctcggtgctgaccggcatcatcgcctccacc
gtcctctggtggatcttgcgcaagattcaaaccccgaccgacgtggaccgcggcgagcat
gagacgctgcgagatgtccaccattcacgggtcgaacgggtcttccgctaccttcaaacc
atcaccgcctgcttcgtcgcatttgcccacggctccaacgacgtcgccaacgccatcggg
ccgctggccggtatcgtcagcctcttcgacggcaccacattccagggctcggatgcgctg
ggctctgcggttcccgtccccacctgggtccttatgatcggtggtgtcggcatcctggtt
ggcctggcgacctacggctataaggtcatcgagaccatcggcaccaagatcaccgatatc
accccgagccgcggcttcgccgcagaattcggcgccgcaaccaccatcctcatcggcagc
aagatcggcctgccgctgtcgaccacccacaccatcgtcggcgcggttatcggcgtcggt
tttgcccgcggcatgaacgccctgaacctgcagattatctggcagatcgccaaggcgtgg
gtctacacaatccccttcaccgccgtgctcaccgtggtgatcttcaaggtgctacaatat
ttcttccttgtttga

DBGET integrated database retrieval system