KEGG   Bradymonas sediminis: DN745_05365Help
Entry
DN745_05365       CDS       T05497                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bsed  Bradymonas sediminis
Pathway
bsed00450  Selenocompound metabolism
bsed00970  Aminoacyl-tRNA biosynthesis
bsed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DN745_05365
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DN745_05365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsed01007]
    DN745_05365
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsed03016]
    DN745_05365
Enzymes [BR:bsed01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DN745_05365
Amino acid related enzymes [BR:bsed01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DN745_05365
Transfer RNA biogenesis [BR:bsed03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DN745_05365
 Prokaryotic type
   Other AARSs
    DN745_05365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AWV88798
UniProt: A0A2Z4FJD9
Position
1442277..1444217
Genome map
AA seq 646 aa AA seqDB search
MADFYVTTPIYYVNGAPHIGHAYTTIVADVFARHYRQRGDEVFFLTGTDEHGLKVQRAAE
EQGISPQELVDTNSAKFRDLFAKLELTHDRFVRTTEADHKDAVVEMVRRMKAAGDIYLDT
YAGWYSASDEAYYSEDEIEDGKAIESGSAVEWVEEKSYFFRLSKYEQPLIEWYNSQDIPV
RPKARRNEIAAFVEGGLNDLSISRTTFNWGIEFPEDPEHVLYVWVDALTNYITGIGGFDE
KGEPAKFWPADLHLIGKDILRFHAVYWPAFLMSAGVELPKQVFAHGWWTVDGQKMSKSRG
NWVDAFELVEQYPLDLLRYFMIREIPLGSDGNFVQERIVERNNSELADNLGNLVNRTTKM
MQGFLGGTVPKSVETDVEADVSLRECAAKTLTEVRDSMDKREPHHALESIMHLGNELNQY
IQSTQPWKAKKEGDSERVEQILYHALEGIRWMAVLVQAFVPDAAAKILVAFGLDPVEGAR
LDALQWGGLPAGNTITTPDVLFEKIELDVPKPVEKEPKKKSKKKGDKKMNKDDAEGSGLI
EFGDFLKVKMAVGRILSAERVDGADKLLKLSADVGEDAPRTIVAGLALAFEPEDLVNKQV
AMVVNLKPAKLFGIKSEAMVLAVKDADGGLELAFFSDNIVPGTQIS
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttttacgttacgacaccgatctattacgtcaacggcgcgccccatatcggg
catgcgtatacgaccatcgtcgccgatgtttttgcgcgccattatcgccagcgcggcgat
gaggtcttctttttgaccgggaccgatgagcatgggctcaaggtgcagcgggcggccgag
gagcaggggatttcgcctcaagagttggtcgatacgaactcggcgaaatttcgcgattta
ttcgcgaagctcgagctcacccatgaccgcttcgtgcggaccacggaggccgaccataaa
gacgcggtggtcgagatggtgcggcggatgaaggcggccggcgatatctatctggacacc
tacgcgggttggtattcggcctcggacgaagcctattattccgaagatgagatcgaggat
ggcaaggccattgagtcgggatcggcggtggagtgggtcgaggagaagagctatttcttc
cggctgagtaaatacgagcaaccgcttattgaatggtataattctcaggatattccggtg
cgccccaaggcgcggcgaaacgagatcgcggcgtttgtcgagggcgggctcaacgacctg
tcgatcagccgaacgacctttaattggggcatcgagtttcccgaagaccccgagcacgtg
ctctacgtgtgggtcgacgcgctgaccaattatatcaccggcatcggcggctttgatgag
aagggcgagccggcaaaattctggccggcggatcttcaccttattggcaaggatatcctg
cgctttcacgccgtctattggccggcctttttgatgagcgccggggtggagctcccgaag
caggtcttcgcccacgggtggtggaccgtcgacgggcaaaagatgagcaaatcgcgcggc
aattgggtcgacgcctttgagctggtcgagcaatacccgctcgatcttttgcgctacttt
atgatccgcgagatcccgctgggcagcgacggcaatttcgtccaggagcgcatcgtcgag
cgcaacaactccgagctcgccgataacctcgggaacctcgttaatcgcacgaccaagatg
atgcagggatttttgggcggcacggtgccgaagtcggttgagacggatgttgaagccgat
gtctcgctgcgcgaatgcgccgccaagacgctcaccgaagttcgcgactctatggataag
cgcgagccgcatcacgcgcttgagtcgatcatgcacctgggcaacgagctcaaccaatat
atccagtcgacccagccctggaaggccaaaaaagagggcgattccgagcgggtcgaacag
attctttatcacgcgctcgagggcatccgctggatggccgtgctcgtgcaggcgtttgtg
ccggacgcggcggccaagatcctcgtggccttcgggctcgacccggtcgagggtgcgcgt
ctggatgcgctccagtggggcggtttgccggccggaaataccatcacgaccccggacgta
ctcttcgagaagatcgagctagacgtgccgaagcccgttgaaaaagagccgaagaaaaaa
tccaagaagaagggcgataagaagatgaacaaagatgatgcggagggcagcggcctgatc
gaatttggcgacttcctcaaggtgaagatggccgtcggacgcatcttaagcgccgagcgg
gtcgacggggccgataagctgcttaaattgtcggcagatgtcggcgaggacgcgccgcgt
accatcgtcgccgggttggcgctggcgtttgagcccgaggacctggtcaacaagcaggtg
gcgatggtcgtgaacctgaagcctgcgaaattatttggcattaaatccgaggcgatggtg
ttggctgttaaggacgccgatggcggacttgagctggcctttttctccgataatatcgtg
cccgggacccaaatttcctga

DBGET integrated database retrieval system