KEGG   Burkholderia seminalis: WJ12_00425Help
Entry
WJ12_00425        CDS       T04851                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00790  Folate biosynthesis
bsem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WJ12_00425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsem04147]
    WJ12_00425
Enzymes [BR:bsem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     WJ12_00425
Exosome [BR:bsem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WJ12_00425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AOJ26235
UniProt: A0A103K8F6
Position
1:complement(97744..98052)
Genome map
AA seq 102 aa AA seqDB search
MIHKLTSEERKTRLAGLPLWTAVPGRDAIQRSLRFADFNEAFGFMTRVAIKAQEMNHHPE
WFNVYNRVDVTLSTHDADGLTERDIELALFIDRAGAHAQPSA
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgatccacaagctcacatcagaagaacgcaagacccggctcgcaggcctgccgctctgg
acggccgtgccgggccgcgacgccatccagcgcagcctgcgcttcgccgatttcaacgaa
gcgttcggcttcatgacgcgcgtcgcgatcaaggcgcaggaaatgaaccaccatccggaa
tggttcaacgtgtacaaccgcgtcgacgtcacgctgtcgacccacgacgccgacggcctg
accgaacgcgacatcgaactcgcgctgttcatcgaccgcgccggcgcgcacgcgcaaccg
tccgcctga

DBGET integrated database retrieval system