KEGG   Burkholderia seminalis: WJ12_02160Help
Entry
WJ12_02160        CDS       T04851                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsem00627  Aminobenzoate degradation
bsem01100  Metabolic pathways
bsem01110  Biosynthesis of secondary metabolites
bsem01120  Microbial metabolism in diverse environments
bsem01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    WJ12_02160
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    WJ12_02160
Enzymes [BR:bsem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     WJ12_02160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AOJ23724
UniProt: A0A103KD00
Position
1:complement(482672..483268)
Genome map
AA seq 198 aa AA seqDB search
MASPSAPPRRLIVAITGATGAIYGVRLLDLLRAAGGVETHLLISNAGWLNIQHELKLPKA
EVERRADVVHSVRDVGATIASGSFATDGMVIAPCSMKTLASVAHGLSDNLITRAADVTLK
ERRRLVLMVRETPFNLAHLRNMTAVTEMGGIVFPPLPAFYAMPKTIEELVDQTVTRVLDL
FALSAPQTTPWAGIRHAQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcccagcgcgccgccacgccggctgatcgtcgcgatcaccggcgccaccggc
gcgatctacggcgtccggctgctcgatctgctgcgcgccgcgggcggcgtcgaaacgcac
ctgctgatttcgaacgccggctggctcaacatccagcatgaactgaagctgccgaaggcc
gaggtcgaacgccgagcggacgtcgtgcactcggtgcgcgacgtcggtgcgacgatcgcg
tcgggttcgttcgcgaccgacgggatggtgatcgcaccctgttcgatgaagacgctcgcg
agcgtcgcgcacgggctgtccgacaacctgatcacacgcgcggccgacgtcacgctgaag
gaacgccgccgtctcgtgctgatggtgcgcgaaacgccgttcaacctcgcgcatctgcgc
aacatgaccgccgtcaccgagatgggcggcatcgtctttccgccgctgcccgcgttctac
gcgatgccgaagacgatcgaggaactcgtcgaccagaccgtcacgcgcgtcctcgacctg
ttcgcgctcagcgcgccgcagacgacaccctgggccggcatccggcacgcgcagtaa

DBGET integrated database retrieval system