KEGG   Burkholderia seminalis: WJ12_02305Help
Entry
WJ12_02305        CDS       T04851                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
bsem  Burkholderia seminalis
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    WJ12_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: AOJ23753
UniProt: A0A103KD22
Position
1:512010..512384
Genome map
AA seq 124 aa AA seqDB search
MSQYQFTVSVKTSYLPEQSDPDHRQYAFAYTLTIRNTGQVAAQLIARHWIITDSENHVQE
VKGLGVVGHQPLLQPGEHFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtatcagttcaccgtttcggtgaaaaccagctacctgccggaacaatccgac
cccgatcaccgtcaatacgcattcgcgtacacgctgacgatccgcaacacgggacaggtc
gcggcgcagctgatcgcgcgtcactggatcatcacggacagcgagaaccacgtgcaggaa
gtgaaggggctcggcgtcgtcgggcaccagccgctgctgcagccgggcgaacacttcgaa
tacacgagctgggccgtgatcgcgacgccggtcggcacgatgcggggcgcgtacttctgc
gtggcggaagacggcgagcgtttcgaggcgccggtcgacgagttcgcactgcacatgccg
cgcacgctgcattga

DBGET integrated database retrieval system