KEGG   Burkholderia seminalis: WJ12_03305Help
Entry
WJ12_03305        CDS       T04851                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bsem  Burkholderia seminalis
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WJ12_03305
Enzymes [BR:bsem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     WJ12_03305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AOJ23930
UniProt: A0A118FSH4
Position
1:complement(735290..736117)
Genome map
AA seq 275 aa AA seqDB search
MTDHTRSATPFRVAALQMVSTPDVTRNLAEAGRLIAEAAGEGAQLVLLPEYFCFMGHRDT
DKLALAEPYRDGPIQRFLADAARRHGIWVIGGTLPLKAPEPDRVLNTTLVFDPSGSEAAR
YDKIHLFNFEKGDESFDEARTIRAGDTVVAFDAPFGRVGLSVCYDLRFPELYRRMGDCAL
IVVPSAFTYTTGRAHWETLLRARAVENQCYVLAAAQGGKHENGRRTWGHSMLIDPWGEIV
AVRDVGASVVPGTIDPQRIAEVRQSLPAWRHRVLT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacacccgttccgccacacccttccgggtcgccgcgctgcagatggtgagc
acgccggacgtcacacgcaatctcgccgaagcgggccgcctgatcgcggaagccgccggc
gaaggcgcgcagctcgtattgctgcccgaatatttttgcttcatgggccaccgcgacacc
gacaagctcgcgctcgccgaaccgtaccgggacggcccgatccagcgcttcctcgcggac
gccgcgcgccgccacggcatctgggtgatcggcggcacgctgccgctgaaggcgcccgag
cccgatcgcgtgctgaacacgacgctcgtattcgatccgtccggcagcgaagccgcgcgc
tacgacaagatccacctgttcaacttcgagaaaggcgacgaatcgttcgacgaggcccgc
acgatccgcgcgggcgacacggtcgtcgcgttcgacgcgccgttcgggcgggtcggcctg
tcggtctgttacgatcttcgctttccggagctgtatcgccggatgggcgactgcgcgctg
atcgtcgttccgtcggcatttacgtatacgacgggccgcgcgcactgggaaacgctgctg
cgcgcgcgggccgtcgagaaccagtgctacgtgctcgcggccgcgcagggcggcaagcac
gagaacggccggcgcacctggggccacagcatgctgatcgatccgtggggcgagatcgtc
gcggtccgcgatgtcggcgccagcgtcgtgcccggcacgatcgatccgcaacgcattgcc
gaggtgcgccagagcctgcccgcatggcggcaccgcgtactgacctga

DBGET integrated database retrieval system