KEGG   Burkholderia seminalis: WJ12_13740Help
Entry
WJ12_13740        CDS       T04851                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00903  Limonene and pinene degradation
bsem00930  Caprolactam degradation
bsem01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    WJ12_13740
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    WJ12_13740
Enzymes [BR:bsem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     WJ12_13740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: AOJ25826
UniProt: A0A118FT41
Position
1:complement(3036363..3037325)
Genome map
AA seq 320 aa AA seqDB search
MSWQSKLACWLLRWQFRPETTREVLDPARARRFTDLRMIVPRRAPSGYRLRQCHGAGDAP
LRGEWLERTDASAGRGPGRTLLYFHGGGYYFCSTRTHRPLVFGLTKRAGVRSFSLDYRLA
PENRFPAALDDALAAYRQLLALGTPPESIVLGGDSAGGGLALATLVALRDRGEPLPAGAI
LFSPWTDLAATGATLRTNDGADPMFAGSALPKAAKLYLGDTPATHPYASPLYADFTGLPP
LYIQVGSTEVLLDDSRRVAEQAKAAGVAVEIEVWPDMPHVWQLYAPMMPEARDALDRAAA
FLRRVAVERAVQRVGEASIA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcaaagcaagctcgcctgctggctgctgcgctggcagtttcgtcccgagacc
acgcgcgaggtgctcgaccccgcgcgtgcgcggcgctttaccgatctgcgaatgatcgtg
ccgcgccgcgcgccgtcgggctaccggctgcgccagtgccatggcgcgggcgatgcgccg
ctgcgcggcgagtggctcgagcgcaccgacgcgagcgcggggcgcgggcccggccgcacg
ctgctgtacttccacggcggcggttattacttctgttcgacgagaacgcaccggccgctg
gtgttcggcctgacgaagcgtgcgggtgtgcgctcgttctcgctcgactaccggctcgcg
cccgaaaaccgtttcccggccgcgctcgacgatgcgctcgcggcctaccggcaactgctg
gcgctcggcacgccgcccgagtcgatcgtgctcggcggcgattcggcgggcggcggcctc
gcgctcgcgacgctcgtcgcgctgcgcgatcgcggcgaaccgttgccggccggcgcgatc
ctgttctcgccgtggaccgatctcgcggccaccggcgcgacgctgcgcaccaacgacggc
gccgatccgatgtttgccggctcggcgctgccaaaggccgcgaagctgtacctcggcgac
acgccggcaacgcatccgtacgcatcgccgctctacgcggatttcacgggcctgccgccg
ctgtatatccaggtcggcagcaccgaggtgctgctcgacgattcgcgccgcgttgccgag
caggcgaaggcggccggcgtggcggtggagatcgaggtgtggcccgacatgccgcacgtg
tggcagttgtacgcgccgatgatgccggaagcgcgcgacgcgctcgaccgcgcggccgcg
ttcctgcgccgcgtcgcggtcgaacgcgcggttcagcgcgtcggcgaggcgtcgatcgcc
tga

DBGET integrated database retrieval system