KEGG   Burkholderia seminalis: WJ12_18095Help
Entry
WJ12_18095        CDS       T04851                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00071  Fatty acid degradation
bsem00072  Synthesis and degradation of ketone bodies
bsem00280  Valine, leucine and isoleucine degradation
bsem00310  Lysine degradation
bsem00362  Benzoate degradation
bsem00380  Tryptophan metabolism
bsem00620  Pyruvate metabolism
bsem00630  Glyoxylate and dicarboxylate metabolism
bsem00640  Propanoate metabolism
bsem00650  Butanoate metabolism
bsem00900  Terpenoid backbone biosynthesis
bsem01100  Metabolic pathways
bsem01110  Biosynthesis of secondary metabolites
bsem01120  Microbial metabolism in diverse environments
bsem01130  Biosynthesis of antibiotics
bsem01200  Carbon metabolism
bsem01212  Fatty acid metabolism
bsem02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WJ12_18095
   00630 Glyoxylate and dicarboxylate metabolism
    WJ12_18095
   00640 Propanoate metabolism
    WJ12_18095
   00650 Butanoate metabolism
    WJ12_18095
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WJ12_18095
   00072 Synthesis and degradation of ketone bodies
    WJ12_18095
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WJ12_18095
   00310 Lysine degradation
    WJ12_18095
   00380 Tryptophan metabolism
    WJ12_18095
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WJ12_18095
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WJ12_18095
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WJ12_18095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsem04147]
    WJ12_18095
Enzymes [BR:bsem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WJ12_18095
Exosome [BR:bsem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WJ12_18095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: AOJ26826
UniProt: A0A103KD93
Position
3:complement(499460..500653)
Genome map
AA seq 397 aa AA seqDB search
MSNAAKEVVVVSGVRTAIGDFGGSLKDFSPTDLGAKVVAEVLSRANVSGEAVGHVVFGHV
VNTEPKDMYLARVAAINGGVAQHAPALTVNRLCGSGLQAIVSAAQTIMLGDADVAIGGGS
ESMSRAPYTVPAARFGQRMGDGKLVDMMLGALHDPFQTIHMGVTAENVAKQYDISRDAQD
ALALESHRRAARAIAEGRFKDQILPISIRTKKGEVAFDTDEHVRHDASADDFTKLKPVFA
KENGTVTAGNASGINDAAAAVLMMSADAARTQGVKPLARLVAYAHAGVDPAYMGIGPVPA
TRKALERAGLKITDLDVIEANEAFAAQACAVTQELGLDPAKVNPNGSGISLGHPIGATGA
LITVKALYELKRIGGRYALVTMCIGGGQGIAAIFENI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcagcgaaggaagtcgtggtggtgagcggtgttcgtaccgcgatcggtgat
ttcggcggcagcctgaaggatttctcgccgaccgatctcggcgcgaaggtggtggccgaa
gtgctgtcgcgcgcgaacgtgtcgggcgaagcggtcggccatgtcgtgttcggccacgtc
gtgaacaccgagccgaaggacatgtatctcgcgcgcgtcgcggcgatcaacggcggggtc
gcgcagcacgcgccggcactgaccgtgaaccgtctgtgcggctccggcctgcaggcgatc
gtgtcggccgcgcagacgatcatgctgggcgatgccgatgtcgcgatcggcggcggctcg
gagagcatgagccgcgcgccgtacacggtgccggccgcgcgtttcggccagcgcatgggc
gacggcaagctcgtcgacatgatgctcggcgcgctgcacgatccgttccagacgatccac
atgggcgtgacggccgagaacgtcgcgaagcaatacgacatctcgcgcgacgcgcaggat
gcgctggcgctcgaatcgcatcgtcgcgcggcgcgcgcgatcgcggaagggcgcttcaag
gaccagatcctgccgatctcgatccgtacgaagaagggcgaggtggcgttcgataccgac
gagcacgtgcgtcacgacgcgagcgcggacgatttcacgaagctcaagccggtgttcgcg
aaggagaacggcaccgtgacggccggcaacgcatcgggcatcaacgatgcagccgcggcc
gtgctgatgatgagcgcggatgccgcgcgcacgcagggcgtgaagccgctggcccgcctc
gtcgcgtatgcgcacgcgggcgtcgatccggcctacatgggcatcggcccggtgccggcc
acgcgcaaggcgctcgaacgcgcgggcctgaagatcaccgatctcgacgtgatcgaggcg
aacgaggcgtttgccgcgcaggcctgcgcggtcacgcaggaactcggcctcgatcccgcg
aaggtcaacccgaacggctcgggcatctcgctcggtcacccgatcggcgcgaccggtgcg
ctgatcacggtgaaggcgctgtacgaactgaagcgcatcggcgggcgttacgcgctcgtg
acgatgtgtatcggcggcggccagggtattgctgcgatcttcgagaacatctga

DBGET integrated database retrieval system