KEGG   Burkholderia seminalis: WJ12_18330Help
Entry
WJ12_18330        CDS       T04851                                 

Gene name
cpsB
Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00051  Fructose and mannose metabolism
bsem00520  Amino sugar and nucleotide sugar metabolism
bsem01100  Metabolic pathways
bsem01110  Biosynthesis of secondary metabolites
bsem01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    WJ12_18330 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    WJ12_18330 (cpsB)
Enzymes [BR:bsem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     WJ12_18330 (cpsB)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     WJ12_18330 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AOJ26866
UniProt: A0A103KC12
Position
3:complement(558158..559681)
Genome map
AA seq 507 aa AA seqDB search
MSEIELIDKACHADPGVQDRHRVAAGAVVPVVLAGGSGTRLWPMSREQHPKQLTHLVGDE
TLLESTLRRVSGLGSAFGLAAAQVVCGDAHRHTTVRQLAAGGLRARVVVEPARRDTAPAM
TLAAALALAEHGDAVLVVMPADHAIHDTSGFERAMATALRYARLGCIATLGVRPTHADSG
FGYLRTGGQVSLDGAAGGYTLDAFVEKPAPEIAAQYVASGSHWWNSGIYVVRASVWLRAI
EALAPDIHAACVAAIRDGRADDGCFHPAPEPFAASPSDSIDYAVMERLAAMTEPPVAVAV
PLDAGWSDLGSWDAVWAALDKDEDGNAGRGRVMFEDATACYAHSEGRLVACVGVSNVAVV
ETPDAVLVVDRQHVQGVRSLVARIKAEHGAEAETHRLVRRPWGWYDSVDRGERFQVKRIV
VDPGARLSLQMHHHRAEHWTVVKGTATVTRGDEQFLLGENESTYIPIGVRHRLENPGRLP
LEIIEVQTGSYLGEDDIVRFDDAYGRA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatcgagttgatcgacaaggcgtgccatgccgatccgggcgttcaggatcgg
catcgtgtcgccgcgggcgcggtggtgccggtggttctggccggcgggtcgggaacccgg
ctgtggccgatgtcccgcgagcagcacccgaaacaactcacgcatctcgtcggcgacgaa
acgctgctcgaatcgacgctgcgcagggtgagcggactcgggtcggcattcgggctggct
gctgcacaggtcgtatgcggcgacgcgcatcggcacaccacggtgcggcagcttgcggcc
ggcggcctgcgggcgcgcgtggtcgtcgagccggcgcgccgcgatacggcgcccgcgatg
acgctcgcggcagcccttgcgctggccgagcacggcgacgccgtgctggtcgtcatgccg
gccgatcacgcgatccacgacacgtccggtttcgagcgtgcgatggcaaccgcattgcgt
tacgcgcggctcgggtgcatcgcgacgctcggcgtccggccgacgcatgccgattcgggc
ttcggttatctgcgtaccggtggccaggtctcgctggacggcgccgccggcggctacacg
ctcgatgcgttcgtcgaaaagcccgcgcccgaaatcgcggcgcagtacgtcgcgtcgggc
tcgcactggtggaacagcggcatttacgtggtccgggcgagtgtctggctgcgcgcgatc
gaggcacttgcgccggacattcacgcagcgtgcgtcgccgcgatccgcgatggccgcgcg
gacgacggctgctttcacccggcgccggaaccgttcgccgcgagcccgtcggattcgatc
gactacgcggtcatggagcggctggccgcgatgaccgaaccgccggtggccgtcgccgtg
ccgctggatgcaggctggtccgacctcgggtcgtgggacgccgtctgggccgcgctcgac
aaggacgaggacggcaacgccgggcgcggacgcgtgatgttcgaggacgcgactgcgtgc
tatgcgcattcggaaggccggctcgtcgcgtgtgtcggcgtcagcaacgtggcggtggtg
gaaacgcccgacgccgtgctggtcgtggaccggcagcacgttcagggcgtaaggtcgctc
gtggcccggatcaaggccgaacatggcgcggaagccgagacgcaccggctcgtgcggcgc
ccgtggggctggtacgactcggtcgaccgcggcgaacgcttccaggtcaagcggatcgtg
gtggatcccggcgcgcgtctgtcgttgcagatgcaccatcaccgcgccgagcactggacc
gtcgtgaaaggcaccgcgaccgtcacgcgcggcgacgagcaattcctgctcggcgaaaac
gaatcgacctacatcccgatcggcgtgcggcaccggctcgagaaccccgggcgcttgccg
ctggaaatcatcgaagtgcagaccggcagctatctcggcgaagacgacatcgtgcgcttc
gacgatgcatacgggcgcgcgtga

DBGET integrated database retrieval system