KEGG   Burkholderia seminalis: WJ12_19785Help
Entry
WJ12_19785        CDS       T04851                                 

Definition
(GenBank) dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00361  Chlorocyclohexane and chlorobenzene degradation
bsem00625  Chloroalkane and chloroalkene degradation
bsem01100  Metabolic pathways
bsem01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    WJ12_19785
   00361 Chlorocyclohexane and chlorobenzene degradation
    WJ12_19785
Enzymes [BR:bsem01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     WJ12_19785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AOJ27121
UniProt: A0A118FN74
Position
3:897922..898590
Genome map
AA seq 222 aa AA seqDB search
MIQFEPKYITFDCYGTLTHFRMAETAREIYADRLSPAAMEAFVRAFAAYRLDEVLGAWKP
YRDVVVNAVRRTCARLGVKFDEAEAELFYHAVPTWGPHPDVPAGLSRLASKYKLVILSNA
MDEQIMSNVDKLGAPFHAVFTAQQAQSYKPRMQGFEYMFDKLGCKPEDVLHVSSSLRYDL
MTAEDLGIKHKAFVNRGHEPGTPFYNYYEVSDIGQLATQLGL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatccagtttgaaccgaagtacatcaccttcgactgctacggcacgctgacccatttc
cggatggccgagacggcgcgcgaaatctatgcggaccggctgtcgccggccgcgatggag
gcattcgtgcgcgcgttcgccgcctatcggctcgacgaggtgctcggcgcgtggaagccg
taccgcgacgtcgtcgtcaacgcggtccgccgcacctgcgcgcggctcggcgtgaagttc
gacgaggccgaggccgagcttttctatcatgcggtgccgacgtggggcccgcatccggac
gtgccggccgggctgtcgcggctggcgtcgaagtacaagctggtgatcctgtcgaatgcg
atggacgagcagatcatgagcaacgtcgacaagctgggcgcgccgttccacgccgtgttc
accgcgcagcaggcgcaatcgtacaagccgcggatgcagggcttcgaatacatgttcgac
aagctcggctgcaagcccgaggacgtgctgcacgtgtcgtcgagcctgcgctacgacctc
atgacggccgaggatctcggcatcaagcacaaggcattcgtgaaccgcggccacgagccg
ggcacgccgttctacaactattacgaagtgtcggacatcggtcagctcgcgacgcaactc
gggctgtaa

DBGET integrated database retrieval system