KEGG   Burkholderia seminalis: WJ12_28425Help
Entry
WJ12_28425        CDS       T04851                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bsem  Burkholderia seminalis
Pathway
bsem00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bsem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    WJ12_28425
Enzymes [BR:bsem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     WJ12_28425
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     WJ12_28425
    1.1.1.-  
     WJ12_28425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C DAO NSP10
Motif
Other DBs
NCBI-ProteinID: AOJ28769
UniProt: A0A103KGG5
Position
2:1732388..1733452
Genome map
AA seq 354 aa AA seqDB search
MKAAVWRGRHDIRVEEVPVPQRPPAGWVTIRVHWCGICGSDLHEYVAGPVFIPVDAPHPL
TGLKGQCILGHEFSGEIADLGEGVSGFAVGDRVTADACQHCGTCWYCRHGLYNICENLAF
TGLMNNGAFAEFVNVPAELLYKLPDNFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRVIALEMSAARKQKALEVGASVVIDPKTSDAVAEVKALTGGY
GADVSFECIGHTATAKLAIDVIRKAGKSVMVGIFEEPTPFNFFDIVSTEKEVIGSLAYNG
EFADVIRFIADGRIDVQPLITGRIALGDIVARGFEELVNHKDRNVKIIVQPAVS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgtctggcgcggccgccacgacatccgcgtcgaagaggttcccgttccg
cagcgcccgccggccggctgggtcacgattcgcgtgcactggtgcggcatctgcggctcc
gacctgcatgaatacgtcgcggggcccgtgttcatcccggtcgacgcgccgcatccgctg
acgggactgaaaggccagtgcatcctcggccacgagttcagcggcgagatcgccgatctc
ggcgaaggcgtctccggcttcgcggtcggcgaccgcgtgacggccgatgcgtgccagcat
tgcggcacctgctggtattgccggcacgggctgtacaacatctgcgagaacctcgcgttc
accgggctgatgaacaacggcgcgttcgccgaattcgtcaacgtgccggccgaactgctg
tacaagctgcccgacaacttcccgaccgaggccggcgcactgatcgagccgctcgcggtc
gggctgcatgcggtgaagaaggccggcaacatcgtcgggcagaccgtcgtcgtggtcggc
gcgggcacgatcggcctgtgcacgatcatgtgcgcgaaggccgcgggcgccgggcgcgtg
atcgcgctggagatgtcggccgcgcgcaagcagaaggcgctggaagtcggcgcgagcgtc
gtcatcgatccgaagacgtcggacgcggtcgcggaagtaaaggcgctgacgggtggttac
ggcgccgacgtgtcgttcgagtgcatcgggcacacggccaccgcgaagctcgcgatcgac
gtgatccgcaaggccggcaagtcggtgatggtcggcatcttcgaggagccgacgccgttc
aacttcttcgacatcgtgtcgaccgagaaggaagtgatcggctcgctcgcctacaacggc
gagttcgcggacgtgatccgtttcatcgcggacggccgcatcgacgtgcagccgctcatc
accgggcgcatcgcgctcggcgacatcgtcgcgcgcgggttcgaggaactggtcaaccac
aaggaccggaacgtgaagatcatcgtgcagcccgccgtttcctga

DBGET integrated database retrieval system