KEGG   Brucella suis bv. 1: BSS2_I1196Help
Entry
BSS2_I1196        CDS       T03181                                 

Gene name
rplV
Definition
(GenBank) rplV
  KO
K02890  large subunit ribosomal protein L22
Organism
bsf  Brucella suis bv. 1
Pathway
bsf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSS2_I1196 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsf03011]
    BSS2_I1196 (rplV)
Ribosome [BR:bsf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSS2_I1196 (rplV)
  Bacteria
    BSS2_I1196 (rplV)
  Archaea
    BSS2_I1196 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ph1570
Motif
Other DBs
NCBI-ProteinID: AHN46853
Position
I:complement(1197213..1197602)
Genome map
AA seq 129 aa AA seqDB search
MGKAKAPRQLKDNEAKAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIAGTVK
KTLESAIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRGRGRASRIEKPFSHLTIVVR
EVAEKGEAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggccaaggctccccgccagcttaaggataacgaggcgaaagccgtcgcccgt
acgctccgcgtcagcccgcagaagcttaaccttgtcgcgagcatgattcgcggcaagaaa
gtgaatgcggcacttgccgatctgacgttctcgcgcaagcggatcgccggtaccgtcaag
aagacgcttgagtcggcgattgcaaacgctgaaaacaatcacgatctcgacgtcgatgcc
ctgatcgtcgccgaagcctatgtgggcaagtcgatcgtcatgaagcgcttccacgtccgt
ggccgtggccgcgcgagccgtatcgagaagccgttttcgcatctcaccattgttgtccgc
gaagtcgcggaaaaaggggaggccgcataa

DBGET integrated database retrieval system