KEGG   Brucella suis bv. 1: BSS2_I1717Help
Entry
BSS2_I1717        CDS       T03181                                 

Gene name
phbA-1
Definition
(GenBank) phbA-1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsf  Brucella suis bv. 1
Pathway
bsf00071  Fatty acid degradation
bsf00072  Synthesis and degradation of ketone bodies
bsf00280  Valine, leucine and isoleucine degradation
bsf00310  Lysine degradation
bsf00362  Benzoate degradation
bsf00380  Tryptophan metabolism
bsf00620  Pyruvate metabolism
bsf00630  Glyoxylate and dicarboxylate metabolism
bsf00640  Propanoate metabolism
bsf00650  Butanoate metabolism
bsf00900  Terpenoid backbone biosynthesis
bsf01100  Metabolic pathways
bsf01110  Biosynthesis of secondary metabolites
bsf01120  Microbial metabolism in diverse environments
bsf01130  Biosynthesis of antibiotics
bsf01200  Carbon metabolism
bsf01212  Fatty acid metabolism
bsf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSS2_I1717 (phbA-1)
   00630 Glyoxylate and dicarboxylate metabolism
    BSS2_I1717 (phbA-1)
   00640 Propanoate metabolism
    BSS2_I1717 (phbA-1)
   00650 Butanoate metabolism
    BSS2_I1717 (phbA-1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSS2_I1717 (phbA-1)
   00072 Synthesis and degradation of ketone bodies
    BSS2_I1717 (phbA-1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSS2_I1717 (phbA-1)
   00310 Lysine degradation
    BSS2_I1717 (phbA-1)
   00380 Tryptophan metabolism
    BSS2_I1717 (phbA-1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSS2_I1717 (phbA-1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSS2_I1717 (phbA-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSS2_I1717 (phbA-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsf04147]
    BSS2_I1717 (phbA-1)
Enzymes [BR:bsf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSS2_I1717 (phbA-1)
Exosome [BR:bsf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSS2_I1717 (phbA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHN47365
Position
I:complement(1702447..1703631)
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGCPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggttgcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaagggggatgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttgatccgtcgatcatgggaaccgggccgattcccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system