KEGG   Brucella suis bv. 1: BSS2_II0962Help
Entry
BSS2_II0962       CDS       T03181                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsf  Brucella suis bv. 1
Pathway
bsf00010  Glycolysis / Gluconeogenesis
bsf00053  Ascorbate and aldarate metabolism
bsf00071  Fatty acid degradation
bsf00280  Valine, leucine and isoleucine degradation
bsf00310  Lysine degradation
bsf00330  Arginine and proline metabolism
bsf00340  Histidine metabolism
bsf00380  Tryptophan metabolism
bsf00410  beta-Alanine metabolism
bsf00561  Glycerolipid metabolism
bsf00620  Pyruvate metabolism
bsf00625  Chloroalkane and chloroalkene degradation
bsf00903  Limonene and pinene degradation
bsf01100  Metabolic pathways
bsf01110  Biosynthesis of secondary metabolites
bsf01120  Microbial metabolism in diverse environments
bsf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSS2_II0962
   00053 Ascorbate and aldarate metabolism
    BSS2_II0962
   00620 Pyruvate metabolism
    BSS2_II0962
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSS2_II0962
   00561 Glycerolipid metabolism
    BSS2_II0962
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSS2_II0962
   00310 Lysine degradation
    BSS2_II0962
   00330 Arginine and proline metabolism
    BSS2_II0962
   00340 Histidine metabolism
    BSS2_II0962
   00380 Tryptophan metabolism
    BSS2_II0962
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSS2_II0962
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSS2_II0962
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSS2_II0962
Enzymes [BR:bsf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BSS2_II0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AHN48724
Position
II:complement(1003556..1005049)
Genome map
AA seq 497 aa AA seqDB search
MTQENKMGKHENKAGGASLLHYGNFIAGQWQDAVGGEHITLKNPSDGSDLAPIARGAKAD
IDLAVVAARSALSGDWGKLTATERGRILHRISEEVLKNIDLLTDLESKDVGKPVTQARAD
VVALARYLEFYGASADKVHGDTLPYQNGFTVLSIYEPHGVTGHIIPWNYPMQILGRSLGA
ALAMGNAAVVKPAEEACLTILEFARIAEKAGLPKGALNVVTGFGAEAGAALCEHPDVNHI
SFTGSVRTGEVVQAAAAKNTVPVTLELGGKSPQIVFADADLDRALPFLVNAGIQNAGQTC
SASSRILVERSIYEEVIARMSERYRALKVGPASADLSVGPVVSQRQKAIVDGYLDLAKES
GLAIAAQGVLAEGAPEGGAYVLPTLIRDVPADHRLAQEEIFGPVQVILPFDTEEEAIAIA
NGTHYGLVCGIWTNDGGRQFRLAHAIHSGQVFINNYGAGGGIELPFGGVKKSGHGREKGF
EALYGFASLKTISVYHG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagaaaataagatggggaagcatgaaaacaaggcaggaggagccagcttgctt
cattatggcaatttcatcgcgggccagtggcaggatgccgttggcggcgagcatatcaca
ctcaagaatccttccgatggcagtgatctggcgccgattgcacgcggcgccaaggctgat
atcgatctggccgtcgtggcggcccgtagcgcgctttccggtgactggggcaagctgacg
gcaaccgagcgcggccgcatcctgcaccgcatttcggaagaagtgctgaagaatatcgat
ctgctgacggatctggaatcgaaggatgttggcaagcccgttacacaggcgcgtgccgat
gtggtggcgctggcgcgttatctcgaattctacggtgcttccgccgacaaggtgcatggc
gatacgctgccttatcagaacggtttcacggttctgtcgatctacgagccgcatggtgtc
acaggccacatcattccgtggaactatccgatgcagattctgggccgcagccttggtgcc
gcactggccatgggcaatgcggcggtggtgaaacctgccgaagaagcttgcctcaccatt
ctggaatttgccaggatcgcggaaaaggctggcctgcccaaaggtgcgctcaatgtcgtc
acgggatttggtgcggaagccggtgcggcgctctgcgaacatcccgatgtcaaccatatt
tcgtttaccggctccgttcgcactggcgaggtggttcaggcggcggcagcaaagaacacc
gtgccggtgacactggaactgggcggcaagtctccgcagatcgtctttgccgatgccgat
ctcgaccgtgccttgccgtttctggtcaatgcgggcatccagaatgccggtcagacctgt
tctgcttcgtcgcgtattctggtcgagcgcagtatttatgaagaagtcatcgcgcgcatg
agcgagcgttaccgggcgctgaaagtcggtccggccagtgccgatctttctgtcggtcct
gtcgtgtcacagcgccagaaggcgattgtggatggctatctcgatctggcgaaagaaagc
gggctcgccattgccgcgcaaggtgtgctggcagaaggcgcgccggaaggcggggcctat
gtcctgccgacgctgatccgtgatgtgcctgccgatcatcgtctggcgcaggaggaaatt
tttggccccgtgcaggtgatcctgcctttcgacacggaagaagaagccatcgccatcgcc
aatggtacgcattatggcctcgtctgtggtatctggaccaatgatggcggacggcagttc
cgcctcgcacatgccatccattccggtcaggtgttcatcaataattacggtgcggggggc
ggtatcgagctgccgttcggcggcgtgaagaaatccggccatggccgcgaaaaggggttt
gaggcgctctacgggtttgcctcgctgaagaccatttccgtctatcacggctga

DBGET integrated database retrieval system