KEGG   Brucella suis ZW046: IY72_02615Help
Entry
IY72_02615        CDS       T03427                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bsg  Brucella suis ZW046
Pathway
bsg00361  Chlorocyclohexane and chlorobenzene degradation
bsg00625  Chloroalkane and chloroalkene degradation
bsg01100  Metabolic pathways
bsg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    IY72_02615
   00361 Chlorocyclohexane and chlorobenzene degradation
    IY72_02615
Enzymes [BR:bsg01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     IY72_02615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AIN86899
UniProt: A0A4Z0F080
Position
1:complement(532833..533486)
Genome map
AA seq 217 aa AA seqDB search
MSYSSYAFDAYGTLFDVHSAVRRHADKAGPDGRALSELWRAKQLEYSWVLSLMGAYSDFW
KLTEESLDYALAHYPSVDPALRNDLLDAYWKLDCYPEVPAALKALKDRGARLAILSNGSP
AMLEAAVRSAALDVLLDDVISVDMVKKYKTSLAVYELIAVQWRLYPSTISFQSSNRWDVA
GAVRFGMRGVWINRSNEPDEYKQFPPALILPSLHLLD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctacagttcctatgccttcgatgcctatggcacattgttcgatgtccattcggcg
gtgcggcgacatgcggacaaggcggggccggacgggcgggccctgtccgaattgtggcgc
gcaaaacaactggaatattcgtgggttctgagcctgatgggtgcttatagcgatttctgg
aaactgacagaagaatcgctcgattatgcccttgcgcactatccttccgtcgatccggcg
ctgcgcaacgaccttctcgatgcctattggaaactcgattgctacccggaagtgcccgcg
gcgctgaaggccctgaaggatcgtggcgcacggcttgccattctatccaacggctcgccc
gccatgctggaggcggcggtcaggtctgctgccctcgacgtgctgctcgatgatgtcatc
tcggtcgatatggtgaagaaatacaagacctcgcttgcggtctatgagcttattgccgtg
caatggcggctctacccttccaccatctcgttccagtcatcaaaccgctgggatgtggcg
ggcgcggtgcgttttggaatgcgcggcgtgtggatcaaccgttccaacgagccggatgaa
tacaagcagtttcccccggccctcattctgccaagcctgcatcttctggattga

DBGET integrated database retrieval system