KEGG   Brucella suis ZW046: IY72_05835Help
Entry
IY72_05835        CDS       T03427                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bsg  Brucella suis ZW046
Pathway
bsg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    IY72_05835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsg03011]
    IY72_05835
Ribosome [BR:bsg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    IY72_05835
  Bacteria
    IY72_05835
  Archaea
    IY72_05835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ph1570
Motif
Other DBs
NCBI-ProteinID: AIN87485
UniProt: Q075T5
Position
1:complement(1172198..1172587)
Genome map
AA seq 129 aa AA seqDB search
MGKAKAPRQLKDNEAKAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIAGTVK
KTLESAIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRGRGRASRIEKPFSHLTIVVR
EVAEKGEAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggccaaggctccccgccagcttaaggataacgaggcgaaagccgtcgcccgt
acgctccgcgtcagcccgcagaagcttaaccttgtcgcgagcatgattcgcggcaagaaa
gtgaatgcggcacttgccgatctgacgttctcgcgcaagcggatcgccggtaccgtcaag
aagacgcttgagtcggcgattgcaaacgctgaaaacaatcacgatctcgacgtcgatgcc
ctgatcgtcgccgaagcctatgtgggcaagtcgatcgtcatgaagcgcttccacgtccgt
ggccgtggccgcgcgagccgtatcgagaagccgttttcgcatctcaccattgttgtccgc
gaagtcgcggaaaaaggggaggccgcataa

DBGET integrated database retrieval system