KEGG   Brucella suis ZW046: IY72_09175Help
Entry
IY72_09175        CDS       T03427                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bsg  Brucella suis ZW046
Pathway
bsg00020  Citrate cycle (TCA cycle)
bsg00310  Lysine degradation
bsg00380  Tryptophan metabolism
bsg01100  Metabolic pathways
bsg01110  Biosynthesis of secondary metabolites
bsg01120  Microbial metabolism in diverse environments
bsg01130  Biosynthesis of antibiotics
bsg01200  Carbon metabolism
Module
bsg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IY72_09175
  09105 Amino acid metabolism
   00310 Lysine degradation
    IY72_09175
   00380 Tryptophan metabolism
    IY72_09175
Enzymes [BR:bsg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     IY72_09175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AIN88079
UniProt: A0A2D2BRA4
Position
1:complement(1836582..1837808)
Genome map
AA seq 408 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT
AKEGDTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQPAPA
AAKLLAESGLSADQVEGSGKRGQVLKGDVLDAITKGVSAAPAAPVAARPASSADDASREE
RVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVFEKKHGVKLGFMGF
FTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVVPVIRDADQMSIAEVEK
ELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAPQSGILGMHKIQERPMV
VGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaattcgcgttcccacgcttggggagtccgttaccgaggcaaccatcgga
aagtggttcaagaaggctggtgaagccattgctgtcgatgagccgctggtggaactggaa
accgacaaggtgacggtcgaagtgcccgcaccggctgcgggtgttctggccgaaatcacg
gccaaggaaggcgatacggtcgaagtgggcgcactgctcggccagatttccagtgacggg
gcagcggttgccgccgcaccggcccagaagaaggaggaagccaagcctgcagccgccgct
cctgctgctgcaccggtcgcatcggcttcgtcgggcccggccatgcagccggcgccggct
gctgcgaagcttctggctgaaagcggtctttccgccgatcaggtcgaaggttccggcaag
cgcggccaggtgctcaaaggtgacgttctcgacgccatcacgaaaggcgtttcggcggct
cctgccgctccggttgccgcgcgtccggcctcctcggctgatgacgcatcgcgcgaagag
cgtgtgaagatgacccgtctgcgccagaccattgcgcgccgcctgaaggatgcccagaac
acggctgccatgctcaccaccttcaacgaggtggacatgtcggcagtcatggagctgcgt
aacaagtataaggacgtctttgaaaagaagcatggcgtgaagcttggcttcatgggcttc
ttcaccaaggcagtgacgcatgcgctgaaggaaatcccggctgtcaacgccgagatcgac
ggcacggacatcgtctacaagaacttctgccatgtcggcatggctgtcggcaccgacaag
ggcctcgtcgttccggtcatccgcgatgccgaccagatgtcgattgcggaagtggaaaag
gaactggcacgtctcgccagggctgcgcgtgacggctcgctttccatggccgatatgcag
ggcggcacctttaccatcaccaatggcggtgtttacggttcgctcatgtccacgccgatc
ctcaatgcgccgcagtcgggcattctcggtatgcacaagatccaggaacgcccgatggtc
gtcggtggccagatcgtggtccgcccgatgatgtatctggcgctttcctacgatcaccgc
atcgtggacggcaaggaagccgtgaccttcctcgtgcgtgtgaaggaaagcctggaagat
ccggaacgtctggttctcgatctctag

DBGET integrated database retrieval system