KEGG   Brucella suis ZW046: IY72_14935Help
Entry
IY72_14935        CDS       T03427                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsg  Brucella suis ZW046
Pathway
bsg00071  Fatty acid degradation
bsg00072  Synthesis and degradation of ketone bodies
bsg00280  Valine, leucine and isoleucine degradation
bsg00310  Lysine degradation
bsg00362  Benzoate degradation
bsg00380  Tryptophan metabolism
bsg00620  Pyruvate metabolism
bsg00630  Glyoxylate and dicarboxylate metabolism
bsg00640  Propanoate metabolism
bsg00650  Butanoate metabolism
bsg00900  Terpenoid backbone biosynthesis
bsg01100  Metabolic pathways
bsg01110  Biosynthesis of secondary metabolites
bsg01120  Microbial metabolism in diverse environments
bsg01130  Biosynthesis of antibiotics
bsg01200  Carbon metabolism
bsg01212  Fatty acid metabolism
bsg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IY72_14935
   00630 Glyoxylate and dicarboxylate metabolism
    IY72_14935
   00640 Propanoate metabolism
    IY72_14935
   00650 Butanoate metabolism
    IY72_14935
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IY72_14935
   00072 Synthesis and degradation of ketone bodies
    IY72_14935
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IY72_14935
   00310 Lysine degradation
    IY72_14935
   00380 Tryptophan metabolism
    IY72_14935
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IY72_14935
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IY72_14935
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IY72_14935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsg04147]
    IY72_14935
Enzymes [BR:bsg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IY72_14935
Exosome [BR:bsg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IY72_14935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIN89130
UniProt: A0A2D2BU74
Position
2:complement(826843..828051)
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
aacccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system