KEGG   Brucella suis ZW046: IY72_16550Help
Entry
IY72_16550        CDS       T03427                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bsg  Brucella suis ZW046
Pathway
bsg00051  Fructose and mannose metabolism
bsg01100  Metabolic pathways
bsg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    IY72_16550
Enzymes [BR:bsg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     IY72_16550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIN89420
UniProt: A0A2D2BVN6
Position
2:1160460..1161119
Genome map
AA seq 219 aa AA seqDB search
MQMNCDSALLARQSIVDAMRSFEEKGFNHGSSGNISVREGGHIWVTPTGATSTMDPQDMS
LVSLEGEHLAGKIPSSEWRIHTEIMRAHPEAGAVVHSHADACVAVLCLRKPLPPFHYMIA
SFGGSEVPCASYRVFGSDALAYEVVRAMGHHRACLMASHGMVVWGRDLAHARLLAEKLET
LARQYILACQIGTPALLSDVELTEVRERYGFYGSQPMPR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgaattgcgattcggcccttttggcccgacagtccatcgtggatgcgatgcgg
tcttttgaggaaaagggattcaatcatggcagcagcggcaacatcagtgttcgggaaggc
gggcatatttgggtgacgccaacgggcgcgacctcgactatggacccgcaggacatgagc
cttgtctcccttgaaggcgagcatctggctggcaaaattccctccagcgaatggcgtatc
cataccgaaatcatgcgggcgcacccggaagccggtgccgtggtccattcccacgcagat
gcctgcgtggcggttctctgcctgcgcaagccccttccgccattccattacatgatcgct
tccttcggcgggagcgaggtgccttgtgcgtcatatcgcgtattcggatcggacgcgctg
gcttatgaagtcgtgcgtgcgatggggcaccatcgcgcctgtctgatggcaagccacggc
atggtggtgtgggggcgggatctcgcacatgccaggctccttgcagaaaagctcgaaacg
ctggcacggcaatatatattggcctgccagatcggaacacccgccctgttgagcgatgtc
gaactgacggaagtccgggaacgctacggtttttacggcagccaacccatgccgcgctga

DBGET integrated database retrieval system