KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_02830Help
Entry
BSU6051_02830     CDS       T02503                                 

Gene name
ycdF
Definition
(GenBank) putative dehydrogenase YcdF
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
bsh00030  Pentose phosphate pathway
bsh01100  Metabolic pathways
bsh01120  Microbial metabolism in diverse environments
bsh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU6051_02830 (ycdF)
Enzymes [BR:bsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BSU6051_02830 (ycdF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AGG59626
Position
305657..306433
Genome map
AA seq 258 aa AA seqDB search
MYKDLTGKTAIVTGSSKGIGKAIAERFGKEKMNVVVNYHSDPSGADETLEIIKQNGGKAV
SVEADVSKEEGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPHEMSLEDWQRVIDVNVTG
TFLGAKAALNHMMKNNIKGNVLNISSVHQQIPRPVNVQYSTSKGGIKMMTETLALNYADK
GIRVNAIAPGTIATESNVDTKKEESRQKQLKKIPMKAFGKPEEVAAAAAWLVSEEASYVT
GATLFVDGGMTLYPSQLE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagatttaaccggaaaaacagcgattgtgacagggtcttcaaaaggaatcggg
aaagccattgcggaacggttcggaaaggagaaaatgaatgttgttgtaaattaccacagc
gacccgtctggagcagatgaaactctggaaatcattaagcagaacggagggaaagccgtc
tcagttgaggcggacgtgtcaaaagaagaggggattcaggcgctcttggacacagcttta
gagcatttcggcacgctcgatgtgatggtaaacaactccggttttaacggcgttgaggcg
atgccgcatgagatgagtcttgaagattggcagagagtgattgatgtcaatgttaccgga
acctttctgggagcgaaagcagcacttaaccacatgatgaaaaacaatatcaagggcaat
gtgctgaatatctcaagtgttcatcagcagattccgcgccctgtaaacgttcagtattcc
acatccaaaggcggcatcaagatgatgacggaaacgctggcgctcaattatgcggataag
ggaatccgcgtcaatgcgatagcgcccggcaccattgccacagaatcaaatgttgatacg
aaaaaggaagagagcaggcaaaaacaattgaaaaaaatcccgatgaaagccttcggaaag
cctgaagaagtggcggcagcagcagcttggctcgtatctgaggaagcaagctatgtgacc
ggcgcaacacttttcgtcgacggcggaatgacactttatccatctcagcttgaatag

DBGET integrated database retrieval system