KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_06240Help
Entry
BSU6051_06240     CDS       T02503                                 

Gene name
bdhA
Definition
(GenBank) acetoin reductase/2,3-butanediol dehydrogenase BdhA
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
bsh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU6051_06240 (bdhA)
Enzymes [BR:bsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BSU6051_06240 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BSU6051_06240 (bdhA)
    1.1.1.-  
     BSU6051_06240 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AGG59975
Position
complement(677908..678948)
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIEHIEEPKTEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVDKPHPLT
NETAPVTMGHEFSGEVVEVGEGVENYKVGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVSVDEELLFKLPDELSYEQGALVEPSAVALYAVRSSKLKAGDKAAVFGCGPI
GLLVIEALKAAGATDIYAVELSPERQQKAEELGAIIVDPSKTDDVVAEIAERTGGGVDVA
FEVTGVPVVLRQAIQSTTIAGETVIVSIWEKGAEIHPNDIVIKERTVKGIIGYRDIFPAV
LSLMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKSQVKILVRPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcaagatggcataaccaaaaggatatccgtattgaacatatcgaagagcca
aaaacggagccgggaaaagtaaagatcaaagtcaaatggtgcggcatctgcggaagtgat
ttacacgaatatctgggcggcccgatctttattccggttgacaaaccgcacccattaaca
aatgaaacggcacctgtcacaatggggcatgaattctccggtgaagttgtcgaagtcgga
gaaggcgttgaaaattataaagttggagaccgcgttgtagtcgagccgatttttgctaca
cacggccaccaaggcgcctacaaccttgatgaacaaatgggattcctcggcttagccggc
ggaggcggcggtttctctgaatacgtctctgtggatgaagagcttttgttcaaacttcct
gatgaattatcatatgaacaaggcgcgctcgttgaaccttctgcagttgctctatacgct
gtccgctcaagcaaactcaaagcaggcgacaaagcggctgtattcggctgcggcccgatc
ggacttcttgtcattgaagcgctgaaggctgccggtgcaactgatatttacgctgttgag
ctttctcctgaacgccagcaaaaagctgaggagcttggcgcgatcatcgttgatccgtct
aaaacagacgatgtagtcgctgagattgcagaacgtacaggaggcggtgttgacgtagca
ttcgaagtcactggtgtcccagtggtgttacgacaagccatccagtccactacaattgcc
ggtgaaaccgtcatcgtcagcatttgggaaaaaggtgctgaaatccatccgaacgatatc
gtaatcaaagaacgtacagtaaaaggaattatcggataccgcgacatcttcccggctgta
ttgtcattaatgaaagaaggctatttctcagccgacaaactcgtaacgaaaaaaatcgta
ctagatgatttgatcgaggaaggcttcggggctcttattaaagagaaaagccaagtcaaa
atccttgttagacctaactaa

DBGET integrated database retrieval system