KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_24170Help
Entry
BSU6051_24170     CDS       T02503                                 

Gene name
mmgA
Definition
(GenBank) degradative acetoacetyl-CoA thiolase MmgA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
bsh00071  Fatty acid degradation
bsh00072  Synthesis and degradation of ketone bodies
bsh00280  Valine, leucine and isoleucine degradation
bsh00310  Lysine degradation
bsh00362  Benzoate degradation
bsh00380  Tryptophan metabolism
bsh00620  Pyruvate metabolism
bsh00630  Glyoxylate and dicarboxylate metabolism
bsh00640  Propanoate metabolism
bsh00650  Butanoate metabolism
bsh00900  Terpenoid backbone biosynthesis
bsh01100  Metabolic pathways
bsh01110  Biosynthesis of secondary metabolites
bsh01120  Microbial metabolism in diverse environments
bsh01130  Biosynthesis of antibiotics
bsh01200  Carbon metabolism
bsh01212  Fatty acid metabolism
bsh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU6051_24170 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU6051_24170 (mmgA)
   00640 Propanoate metabolism
    BSU6051_24170 (mmgA)
   00650 Butanoate metabolism
    BSU6051_24170 (mmgA)
  Lipid metabolism
   00071 Fatty acid degradation
    BSU6051_24170 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BSU6051_24170 (mmgA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU6051_24170 (mmgA)
   00310 Lysine degradation
    BSU6051_24170 (mmgA)
   00380 Tryptophan metabolism
    BSU6051_24170 (mmgA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU6051_24170 (mmgA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSU6051_24170 (mmgA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSU6051_24170 (mmgA)
Enzymes [BR:bsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSU6051_24170 (mmgA)
Exosome [BR:bsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU6051_24170 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGG61816
Structure
PDB: 

Position
complement(2512844..2514025)
Genome map
AA seq 393 aa AA seqDB search
MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQQAGVSGDDVEGNVMGMVVQAG
SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSN
IPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNTAAKEYAISRREQDEWAL
RSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRRDTSLDQLAKLAPIYASDG
SITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKL
LKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM
TLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaacagtcattgtaagtgctgcaagaactccatttggcaaattcggcggagtt
ttgaaagaggtgaaagctgctgagcttgggggcattgtgatgaaggaggcgctgcaacag
gctggagtctctggagatgatgtagaaggaaacgtcatgggcatggttgtccaggccggc
tcagggcagataccttcccgtcaagctgcccgtctggcgggaatgccttggagtgtgccg
tcagaaacactgaataaagtctgtgcttccggccttcgcgctgtcactttatgtgatcaa
atgattcgggcgcaggatgcggacatacttgttgcgggggggatggaaagcatgagcaat
attccgtatgccgttcccgccgggcgctggggagcacggatgggggacggcgagcttagg
gacttaatggtgtatgacggattaacgtgcgcatttgacgaggtgcacatggctgttcac
ggaaatacagctgccaaggaatatgcaatctcacgaagagagcaggacgaatgggcgttg
agaagtcatgcaagggcagctaaggccgccgatgaagggaagtttcaggatgaaattgtt
cccgtcaactggatcggtcgaaaaggaaaaccaaacgttgttgataaagatgaagcgatt
cgccgtgacacaagtctggatcagctcgcaaaacttgctccgatttatgcaagtgacggt
tctatcacagccggcaatgctcctggagtcaatgacggagccggcgcgttcgtgctgatg
tctgaggaaaaagctgctgagcttggcaaacggcctctggctacaattcttggtttttca
actacgggaatgccagcgcacgagctggcggcagcgccagggtttgctattaacaagctc
ctgaaaaagaatggtttaactgtccaagatattgacttgtttgaagtaaatgaagctttt
gcttcagttgttttgacatgtgaaaaaatcgtaggtttcgatcttgaaaaagtaaatgtg
aatggcggtgcgatcgcgctcggccacccgatcggcgcgagcggtgcgagaattctcatg
acgcttgtttatgaattaaagcgacggggagggggtctgggcgttgccgctatttgcagc
ggggcagcacagggagacgccgtcttagtgcaggttcattaa

DBGET integrated database retrieval system