KEGG   Brucella suis 1330: BS1330_I0253Help
Entry
BS1330_I0253      CDS       T02103                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bsi  Brucella suis 1330
Pathway
bsi00340  Histidine metabolism
bsi01100  Metabolic pathways
bsi01110  Biosynthesis of secondary metabolites
bsi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BS1330_I0253 (hisD)
Enzymes [BR:bsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BS1330_I0253 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh NYN
Motif
Other DBs
NCBI-ProteinID: AEM17614
UniProt: Q8G2R2
Structure
PDB: 

Position
I:complement(261344..262636)
Genome map
AA seq 430 aa AA seqDB search
MVTTLRQTDPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREGDSALLDYSRRFDRID
LEKTGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDRYTDALGVELGSR
WTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAG
VSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVL
IVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTLARTETASA
SWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIG
DYVGGCNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAH
AQSVAIRLNL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggtcacaacgctcagacagaccgaccctgattttgaacagaagtttgcggccttcctc
tccggcaagcgcgaggtttcggaagatgtggaccgcgccgtgcgggaaatcgtggatcgt
gtacgccgcgagggtgacagcgcgctgctcgattattcacgccgcttcgaccggatcgat
ctggaaaagaccggcattgccgtcaccgaggccgagatcgatgccgcattcgatgccgct
cccgcctccaccgtcgaagcattgaagcttgcgcgcgaccgtatcgaaaagcaccatgct
cgccagttgccgaaggacgaccgctatacggatgcgcttggcgtcgagcttggctcgcgc
tggacggccatcgaggctgtcggcctctatgtgcctggcggcacggccagctatccaagt
tccgttctgatgaatgcgatgcccgccaaggtcgcaggcgtggaccgcatcgtcatggtg
gtgcccgcacccgatggcaatctcaatccgctggtgctggtggcagcccgccttgcaggc
gtgtcggagatttaccgcgtcggcggcgcgcaggccattgccgcccttgcctatggcacc
gaaacgatccgtcccgtcgccaagatcgtcggccccggcaatgcctatgtggcagcggca
aagcgcatcgtattcggaacggtcggcatcgacatgatcgccgggccatccgaagtgctg
atcgtggccgacaaggacaataacccggactggatcgccgccgatcttctggcacaggcc
gagcacgatacggccgcgcaatccatcctgatgaccaatgacgaggcctttgcccacgcg
gtggaagaagcggtcgaacggcagcttcacaccctggcgcgcactgaaacggcttccgca
agctggcgcgatttcggtgcggtcattctggtcaaggatttcgaggacgcaattccgctt
gccaaccgtattgcggccgagcatctggaaatcgccgtggccgatgcggaggcgttcgta
ccgcgcatccgcaatgccggttccatattcattggcggttatacaccggaagtgatcggc
gattatgtggggggctgcaaccatgtgctgccaacggcgcgctctgcccgtttctcctcc
ggcctttcggtgctcgattatatgaagcgcacctcgcttctcaagctgggctccgagcag
cttcgcgcacttggaccggctgcgatcgagattgcacgcgccgagggtctcgatgcccat
gcccaatccgtcgccattcgtctgaacctatga

DBGET integrated database retrieval system