KEGG   Brucella suis 1330: BS1330_I1454Help
Entry
BS1330_I1454      CDS       T02103                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bsi  Brucella suis 1330
Pathway
bsi00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BS1330_I1454
Enzymes [BR:bsi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     BS1330_I1454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: AEM18787
UniProt: A0A0H3GCH2
Position
I:complement(1417743..1418429)
Genome map
AA seq 228 aa AA seqDB search
MKRSEINEIIRESDAFIRSFGYIMPPFAYWSPEELKQRTAGDVAAIRKARLGWDITDYGQ
GKFADLGLFLFTVRNGNAEDLKRGTGMLYAEKIMISRKNQLSPMHRHVVKAEDIINRGGG
TLVLELFNSRPDGSVDEETDVTVATDGRLVTQKAGAHLKLQPGESVTLLPGNWHAFWGEG
GDVLIGEVSTVNNDLTDNIFREPIGRFSDIEENEQPLHLLVSDYDKWL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctctgaaatcaatgaaatcatccgtgaaagcgatgcctttatccgctcgttc
ggttatatcatgccgccctttgcctattggtcgccggaagagctgaagcagcgcacggct
ggcgatgtggcggcgatccgcaaggcgcggcttggctgggatattaccgattacgggcag
ggcaagtttgccgatctcggcctgtttcttttcacggttcgcaatggcaatgccgaggac
ctgaagcgtggtacaggcatgctctatgccgaaaagatcatgatttcgcgtaaaaatcag
ctttcccccatgcatcgccatgtggtgaaggcggaagatatcatcaatcgcggtggcggg
acgctggtgctggaattgttcaattcgcggcctgatggcagcgtggacgaggaaaccgac
gtgactgtggcgaccgatgggcggcttgttacccagaaggcgggcgcgcatctgaagctc
cagcccggcgagagcgtaacgctcctgcccggcaattggcacgctttctggggtgagggc
ggcgatgtgctgatcggtgaggtttcgactgtcaataacgatctgaccgacaatatcttc
cgcgagccgattggccgcttctcggatatcgaggaaaacgagcagcccttgcatctgctt
gtgtctgattacgacaagtggctatag

DBGET integrated database retrieval system