KEGG   Brucella suis 1330: BS1330_I1642Help
Entry
BS1330_I1642      CDS       T02103                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bsi  Brucella suis 1330
Pathway
bsi00620  Pyruvate metabolism
bsi00630  Glyoxylate and dicarboxylate metabolism
bsi01100  Metabolic pathways
bsi01110  Biosynthesis of secondary metabolites
bsi01120  Microbial metabolism in diverse environments
bsi01200  Carbon metabolism
Module
bsi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BS1330_I1642 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BS1330_I1642 (glcB)
Enzymes [BR:bsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BS1330_I1642 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase FecR
Motif
Other DBs
NCBI-ProteinID: AEM18966
UniProt: Q8FZ50
Position
I:1597141..1599327
Genome map
AA seq 728 aa AA seqDB search
MGSAEKRNYVEIEGLAVAPELVEFLAKEAAPGTGVEPEKFWKGFAAIIRDLAPKNRALLA
KRDELQARIDAWYKENRDKGYSQADYQQFLKDIGYLLPEGGAFSVSTTNVDPEITHIAGP
QLVVPVMNARYALNAANARWGSLYDALYGTDAISEADGAEKGKGYNPKRGEKVIAWAKNF
LDESAPLSTGKWADVAGLAVNDGKLEIRLTDGSATTLKDESQFKGYNGDAASPTNVLLAK
HNMHVDIVINADHPIGKTDPAHIADVVLESAISTIQDCEDSIAAVDAEDKVAVYRNWLGL
MNGKLEDTFEKNGKQMTRRLNGDRTYTAPDGSTLTLKGHSLMLVRNVGHLMTNPAILDAE
GNEVPEGIMDAAFTSLIALHDIGPNGRHMNSREGSVYIVKPKMHGPEEVAFANEIFTRTE
EMLGMKPNTLKIGIMDEERRTTVNLKEAIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPM
IRKGDMKQAAWIGAYEQWNVDIGLECGLSGHAQIGKGMWAMPDMMAAMLEQKIAHPKAGA
NTAWVPSPTAATLHATHYHKIDVAAVQEKLKSRPRAKLDDILSVPVAVRPNWTPDDIQHE
IDNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQHIANWLYHGVVSEAQ
VMETMKRMAAIVDKQNEGDPLYRPMAADFDKSIAFQAACDLVFKGREQPNGYTEPVLHRR
RLELKQAS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcgcagaaaaacgtaactatgtcgagattgaaggcttggctgttgcccctgag
cttgtggaatttctggccaaagaagccgcgcccggcacaggcgtggagccggagaaattc
tggaagggctttgccgccatcattcgcgatctcgcaccaaagaaccgcgccctgctcgcc
aagcgtgacgagcttcaggccaggatcgacgcctggtacaaggaaaaccgcgacaagggc
tacagccaggccgattaccagcagtttctgaaagatatcggctatctcctgccggaaggt
ggagcgttttcggtttcgaccaccaatgtcgatcctgaaatcacccatattgccggtccg
cagcttgtcgtcccggtcatgaatgcgcgctatgcactcaacgccgccaatgcgcgctgg
ggctcgctctatgatgcgctttatggcaccgacgcgatttccgaggccgatggcgcggaa
aagggcaagggctacaatccgaagcgcggtgaaaaggttattgcgtgggcgaagaatttc
ctcgatgaaagcgcaccgctcagcacgggcaaatgggccgatgttgccggtctcgccgtg
aacgacggcaagcttgaaatcaggctgaccgatggttcggcaaccaccttgaaggacgaa
agccagttcaagggctataatggcgatgccgccagcccaacgaatgtgcttcttgccaag
cacaatatgcatgttgatatcgtcatcaatgcagatcacccgatcggcaagaccgatccg
gcgcatattgccgatgtggttctggaatcggccatcagcacgatccaggattgtgaggac
tccattgccgccgtcgatgccgaagacaaggttgccgtctatcgcaactggctcggcctg
atgaatggcaagctggaagacacgttcgagaagaacggcaagcagatgacgcgtcgcctc
aacggcgaccgcacctacacggcaccggacggttccacgctgacgctcaagggccattcc
ttgatgctggtgcgcaatgtcggccacctgatgaccaacccggccattctggacgccgaa
ggcaatgaagtgccggaaggcatcatggatgcagccttcaccagcctgattgcgctgcat
gatatcggccccaatggccgccacatgaattcgcgcgaaggctcggtctatatcgtcaag
ccaaaaatgcatgggccggaagaagtggcattcgcaaatgaaatcttcacccggaccgaa
gaaatgctcggcatgaagccgaatacgctcaaaatcggcatcatggacgaagaacgccgc
acgaccgtcaatctcaaggaggcaatccgcgccgccaaggatcgcgtcgtcttcatcaat
accggcttcctcgaccgcacgggcgacgagatccacacctccatggaagcaggcccgatg
atccgcaagggcgacatgaagcaggctgcgtggatcggcgcctatgaacaatggaatgtc
gatatcggtctggaatgcgggctttccggccatgcgcagatcggcaagggcatgtgggcc
atgcccgacatgatggcggcaatgctggagcagaagatcgcgcatccgaaggccggtgcg
aacaccgcctgggtgccgtcgccgaccgccgccaccttgcacgctacccattaccacaag
atcgatgtagccgccgttcaggaaaagctgaaaagccgtccccgcgccaagctggacgat
atcctgtcggtgccggttgcggtgcgtccgaactggacgccggacgatatccagcacgaa
atcgacaacaatgcacaaggcattctcggctatgtcgtgcgctggatcgatcagggtgtc
ggctgctccaaggtgccggacatcaacaatgtcggcctgatggaagaccgcgcgacgctg
cgcatttccgcgcagcacatcgccaactggctctatcatggcgtcgtgtcagaggcacag
gtgatggaaaccatgaagcgcatggcagccatcgtcgacaagcagaacgaaggcgacccg
ctttatcgcccgatggccgctgattttgacaagtcgattgccttccaggcggcttgcgat
ctggtcttcaagggccgcgaacagccgaacggctacaccgagccggtcctgcatcgccgc
cggctcgaactgaaacaggcttcctga

DBGET integrated database retrieval system