KEGG   Brucella suis 1330: BS1330_I1880Help
Entry
BS1330_I1880      CDS       T02103                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsi  Brucella suis 1330
Pathway
bsi00860  Porphyrin and chlorophyll metabolism
bsi01100  Metabolic pathways
bsi01110  Biosynthesis of secondary metabolites
bsi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BS1330_I1880 (hemD)
Enzymes [BR:bsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BS1330_I1880 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEM19197
UniProt: A0A0H3GDE1
Position
I:complement(1820809..1821516)
Genome map
AA seq 235 aa AA seqDB search
MKRVLVTRPEPAAAQTAAKLRAAGYEPVLLPLSRTVALSFTVPDEVFDALTITSANAFRH
IAPERLLPYRTLPLFAVGEGTAKAAQEAGFKHVIEGGGDAVRLAGTMRQALAPTARVLYL
AGRVRQPVFEDEVAANGLSMMVCDVYDTESVMYPPQALSRILGHAPFVAVMLYSGVAAAS
FVEAMRSITPPFDEKTRFLCISARVAAKLPSSWLQQALVSDHPDEKGLFRLFSKL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggttcttgttacacggcctgagccggcagcagcgcaaaccgcagcaaagctt
cgcgcggcgggctatgagccagtgcttctgccgttgagccgcaccgtggcgctttccttt
accgttcccgatgaagttttcgacgcgctcaccattacgagcgccaatgcctttcgccat
attgcgccggagcggcttttgccctaccgcacgctgccgctttttgctgtgggtgagggg
acagcgaaggctgcgcaggaggccggttttaaacatgtgatcgagggtgggggcgatgcc
gttcgccttgccgggaccatgcggcaggcgctggcgccaactgcgcgcgtcctttatctt
gccgggcgggttcgccagccggtttttgaagatgaggtggcggcaaatggtctttcaatg
atggtttgcgatgtctacgacactgagtcggtcatgtatccgccgcaggcgctttcccgc
attctcggccatgcgccatttgtcgcggtgatgctttattcaggcgtggcggcggccagt
tttgtcgaagcgatgcgctccattacgccgccattcgatgagaagacgcggtttttatgc
atttcggcgcgggttgcggccaaattgccttccagttggctgcaacaggcgctggtttcg
gatcatccagatgaaaaggggcttttccgcttgttttctaaactttga

DBGET integrated database retrieval system