KEGG   Brucella suis 1330: BS1330_II0445Help
Entry
BS1330_II0445     CDS       T02103                                 

Gene name
phbA-2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsi  Brucella suis 1330
Pathway
bsi00071  Fatty acid degradation
bsi00072  Synthesis and degradation of ketone bodies
bsi00280  Valine, leucine and isoleucine degradation
bsi00310  Lysine degradation
bsi00362  Benzoate degradation
bsi00380  Tryptophan metabolism
bsi00620  Pyruvate metabolism
bsi00630  Glyoxylate and dicarboxylate metabolism
bsi00640  Propanoate metabolism
bsi00650  Butanoate metabolism
bsi00900  Terpenoid backbone biosynthesis
bsi01100  Metabolic pathways
bsi01110  Biosynthesis of secondary metabolites
bsi01120  Microbial metabolism in diverse environments
bsi01130  Biosynthesis of antibiotics
bsi01200  Carbon metabolism
bsi01212  Fatty acid metabolism
bsi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BS1330_II0445 (phbA-2)
   00630 Glyoxylate and dicarboxylate metabolism
    BS1330_II0445 (phbA-2)
   00640 Propanoate metabolism
    BS1330_II0445 (phbA-2)
   00650 Butanoate metabolism
    BS1330_II0445 (phbA-2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BS1330_II0445 (phbA-2)
   00072 Synthesis and degradation of ketone bodies
    BS1330_II0445 (phbA-2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BS1330_II0445 (phbA-2)
   00310 Lysine degradation
    BS1330_II0445 (phbA-2)
   00380 Tryptophan metabolism
    BS1330_II0445 (phbA-2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BS1330_II0445 (phbA-2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BS1330_II0445 (phbA-2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BS1330_II0445 (phbA-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsi04147]
    BS1330_II0445 (phbA-2)
Enzymes [BR:bsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BS1330_II0445 (phbA-2)
Exosome [BR:bsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BS1330_II0445 (phbA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEM19921
UniProt: A0A0H3GEZ0
Position
II:complement(436027..437217)
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPHAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccgggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcacgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system