KEGG   Brucella suis 1330: BS1330_II0537Help
Entry
BS1330_II0537     CDS       T02103                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase family protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
bsi  Brucella suis 1330
Pathway
bsi00520  Amino sugar and nucleotide sugar metabolism
bsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BS1330_II0537
Enzymes [BR:bsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     BS1330_II0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 3Beta_HSD adh_short UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AEM20011
UniProt: A0A0H3G6H5
Position
II:522383..523396
Genome map
AA seq 337 aa AA seqDB search
MGAIFNSLTSNTIEKARRHVLVAGGAGFLGSHLCERLLNEGHSVICVDNFSTGRIENIRH
LLNFDGFSFIRHDIVNTLDLRVDEIYNLACPASPPHYQADPVHTMKTNVIGSLNLLELAA
HYKARIFQASTSEVYGDPHVHPQPENYWGNVNSFGPRSCYDEGKRSAETLFHDFHQQYGV
DIRIVRIFNTYGPRMRPDDGRVVSNFIVQALKGEDITVYGDGSQTRSFCYVDDLIEGFHR
LMYSPHAIRVPVNIGNPGEFTVGALAEQIIAMTGSRSRIVYYPLPVDDPRQRRPDITVAK
RELGWEPTVALAQGLEPTIAYFEHQLRKPTGKLVEAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcgatattcaattcactgacttcaaatacaattgaaaaagcgcgtagacatgtc
ctcgtagcagggggcgccggttttctcgggtctcatctttgcgaaagacttttaaacgaa
ggtcattcagtgatctgcgtggataatttttccacgggacgtatcgagaatatccgccat
cttttgaacttcgacgggttcagcttcatccggcacgacatcgtgaatacgctcgatctg
cgcgttgacgaaatctataatctcgcctgtccggcttcgccgccccattatcaggccgat
cccgttcatacgatgaaaaccaacgtcattggctcgctcaatcttctggagttggcggcg
cactacaaggcgcggattttccaggcctcaacttcggaagtctatggcgatccgcatgtt
catccgcagccggaaaactattggggcaatgtcaattccttcggcccgcgctcctgctat
gacgagggcaagcggtctgccgaaacgctgttccacgatttccaccagcaatatggtgtc
gatatccgcattgtcaggattttcaatacctacggtccgcgcatgcgtcccgacgacggc
cgtgtggtgtcgaacttcatcgtgcaggcgctgaagggcgaggacattaccgtctatggg
gatggttcgcagacgcgctccttctgttatgtggacgatctgatcgagggcttccaccgg
ctcatgtatagcccgcacgccattcgtgtgccggtgaatatcggcaatccgggcgaattc
acagtcggcgccctggcagagcagatcattgccatgaccgggtcgcggtcgcgcatcgtt
tattatccgctgccggtcgatgatccgcgccagcgccggcccgacatcaccgttgccaag
cgcgaactcggctgggagccgaccgtggcgctggcccagggcctggaaccgactatcgcc
tatttcgagcatcagttgagaaagccgaccggcaagctggtggaggccgcataa

DBGET integrated database retrieval system