KEGG   Brucella suis 1330: BS1330_II0727Help
Entry
BS1330_II0727     CDS       T02103                                 

Definition
(GenBank) alcohol dehydrogenase, iron-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bsi  Brucella suis 1330
Pathway
bsi00010  Glycolysis / Gluconeogenesis
bsi00071  Fatty acid degradation
bsi00350  Tyrosine metabolism
bsi00625  Chloroalkane and chloroalkene degradation
bsi00626  Naphthalene degradation
bsi01100  Metabolic pathways
bsi01110  Biosynthesis of secondary metabolites
bsi01120  Microbial metabolism in diverse environments
bsi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BS1330_II0727
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BS1330_II0727
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BS1330_II0727
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BS1330_II0727
   00626 Naphthalene degradation
    BS1330_II0727
Enzymes [BR:bsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BS1330_II0727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEM20192
UniProt: A0A0H3GB27
Position
II:718794..719963
Genome map
AA seq 389 aa AA seqDB search
MTTLTAKWNFPTTVLFGPGHIKELPAVLKAAGIEHPLFVTDPGLAKLPVVASTLAVLDAA
GVQYGVFSDVKPNPVESNLHAGVKVFREGRHDGVIAFGGGSALDLGKLIAFQAGQTRPVW
DFEDIGDWWTRADSNAIAPVIAVPTTAGTGSEVGRAGVLTNESIHTKKVIFHPKMLPVTV
IADPELSTGMPPFITVGTGMDALAHCLEAYCAPGFHPMADGIAVEGIRLVFENLPKAYAN
GGDIEARANMMAAAAMGATAFQKGLGAIHSLSHPIGALYDTHHGMTNAVFMPYVLHHNRA
AIEKRIARLADYLGIEGGFDGFADAIMKLRAELGVPRTLPDLIKNLQMDNARKELIAEMA
VADPTAGGNPVELTKNDALKLLNAALEGR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccacattgaccgcgaaatggaactttccgaccactgtgcttttcgggccggggcac
atcaaggagcttccagccgtcctgaaagccgcaggcatcgagcacccgcttttcgtcacc
gatccgggcctcgccaaactgcctgtggtcgcctcgacattggccgttctggatgcggcg
ggcgtgcaatatggcgtgttttccgatgtgaaacccaatccggtcgagagcaatcttcat
gccggcgtaaaggttttccgggaaggcaggcatgacggcgtcatcgcctttggcggcggt
tccgcgctcgatctcggcaagctcatcgcctttcaggccggacagacccggcccgtctgg
gattttgaagatatcggcgactggtggacccgcgccgacagcaacgccatagctcccgtc
attgccgtgccgaccaccgcaggcaccggctcggaagtggggcgcgcgggcgttctcacc
aatgaatccatccatacgaagaaggtcatcttccaccccaaaatgctgcccgtaacggtg
atcgccgatcccgaactttccactggcatgccgcccttcatcacggtgggtacgggcatg
gatgcactggcgcactgccttgaagcctattgcgcaccgggcttccatcccatggccgat
ggcattgccgtggagggcatccgccttgtctttgagaacctgcccaaagcctatgccaat
ggcggggatatcgaagcgcgtgccaatatgatggcagccgctgccatgggcgccacggcc
ttccagaagggcctcggtgcgatccattcgctctcgcaccccatcggcgcgctctatgac
acacatcacggcatgaccaatgccgtcttcatgccctatgtgctgcaccacaaccgggct
gccatcgaaaagcgcattgcccggctggccgattatctcggcatcgaaggcgggttcgac
ggctttgccgatgcgatcatgaagctgcgcgccgaacttggcgtgccgcgcaccctgccc
gatctcatcaagaaccttcagatggacaatgcccgcaaggagctgatcgccgaaatggca
gtggcagatcccaccgcaggcggaaacccggttgaacttacaaaaaacgacgcgctaaag
ttgctcaatgcagcattggaaggtagataa

DBGET integrated database retrieval system