KEGG   Brucella suis 1330: BS1330_II0786Help
Entry
BS1330_II0786     CDS       T02103                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bsi  Brucella suis 1330
Pathway
bsi00071  Fatty acid degradation
bsi00280  Valine, leucine and isoleucine degradation
bsi00281  Geraniol degradation
bsi00310  Lysine degradation
bsi00362  Benzoate degradation
bsi00380  Tryptophan metabolism
bsi00410  beta-Alanine metabolism
bsi00640  Propanoate metabolism
bsi00650  Butanoate metabolism
bsi00903  Limonene and pinene degradation
bsi00930  Caprolactam degradation
bsi01040  Biosynthesis of unsaturated fatty acids
bsi01100  Metabolic pathways
bsi01110  Biosynthesis of secondary metabolites
bsi01120  Microbial metabolism in diverse environments
bsi01130  Biosynthesis of antibiotics
bsi01200  Carbon metabolism
bsi01212  Fatty acid metabolism
Module
bsi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bsi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BS1330_II0786 (fadB)
   00650 Butanoate metabolism
    BS1330_II0786 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BS1330_II0786 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    BS1330_II0786 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BS1330_II0786 (fadB)
   00310 Lysine degradation
    BS1330_II0786 (fadB)
   00380 Tryptophan metabolism
    BS1330_II0786 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BS1330_II0786 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BS1330_II0786 (fadB)
   00281 Geraniol degradation
    BS1330_II0786 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BS1330_II0786 (fadB)
   00930 Caprolactam degradation
    BS1330_II0786 (fadB)
Enzymes [BR:bsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BS1330_II0786 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BS1330_II0786 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BS1330_II0786 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO UDPG_MGDP_dh_N F420_oxidored FAD_binding_3 NAD_Gly3P_dh_N Sacchrp_dh_NADP ApbA 2-Hacid_dh_C NAD_binding_7 Pyr_redox_2 NAD_binding_8 DFP TrkA_N GIDA Pyr_redox Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AEM20248
UniProt: A0A0H3G733
Position
II:complement(774834..777050)
Genome map
AA seq 738 aa AA seqDB search
MAYVNFKVETDADGIALVTWDMPEKSMNVFTVDAMQELNAIIDAVIADDKIKGVVITSGK
ETFSGGADLTMLEGMFKEFQKQKVKDPEGAVQTLFDNVGKMSGLFRKLETCGKPWVSAIN
GTCMGGAFEMSLACHARVASDAPGVKMALPEVKVGLFPGAGGTQRVPRLANQQDALQMMT
TGSSLTAQRAKAMGLVTEIAPAKKLVETAKKLIKGGLKPVQPWDEKGFKLPGGAIYSAAG
ANLWPAATAILRRETSGNYPAALAILKSVYEGLLVPFDTGLKIEQRYFTEILQMTEAGMM
IRSLFVSLQELNKGARRPVDEKPTRLKKIGVIGAGFMGAGIAYVTAKAGIPVVLIDRDQE
SADKGKAHTADLITKEMQKGHATEADKEKLLSLITATPDYAQLEGADLVIEAVFEDREVK
RVATEKAEEVLKSSAVFASNTSTLPITGLAKVSKRPKNFIGIHFFSPVDKMMLVEVILGK
KTSDKALAVALDYVRAIKKTPIVVNDTRGFYVNRCVLRYMSEAYNMLVEGVPAAMIENAA
RMAGMPVGPLALNDETAIDLSQKILKATLADLGPKAVDPRHVELVDKLVNEFDRKGRKNG
KGFYDYPAKPAKKHLWPGLKDLYPQQNPDKIDVKELKERFLVTIALEAARVMEEGIVTDP
READVGSILAFGFAPYTGGTLSYIDGMGAKKFVQLAKDLQKKYGAQFKAPKLLLDMAENG
ETFYQRFNPYKGETKKAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgtaaatttcaaggttgaaaccgacgccgacggcattgctctcgttacatgg
gacatgcccgaaaagtcgatgaatgtcttcaccgtcgatgcgatgcaggaactgaatgca
atcatcgatgcggtgatagctgacgacaagatcaagggtgttgtcatcacctccggcaag
gaaaccttctccggcggtgccgacctgaccatgctggaaggcatgttcaaggaattccag
aagcagaaggtcaaggaccccgaaggcgcggttcagaccctgttcgacaatgtcggcaag
atgagcggcctgttccgtaagcttgaaacctgcggcaaaccgtgggtttcggctatcaac
ggcacctgcatgggcggcgcatttgaaatgtcgctcgcctgccatgcgcgtgtggcgtcc
gatgcgccgggcgtgaagatggccctgccggaagtgaaggtcggccttttccccggtgct
ggcggcacgcagcgcgttccgcgccttgccaaccagcaggacgcgcttcagatgatgacg
acgggttcaagcctcaccgcgcagcgcgccaaggctatgggccttgtcaccgagattgct
ccggccaagaagctggtcgaaacagccaagaagctcatcaagggtggcctcaagccggtt
cagccctgggatgaaaagggcttcaagctgccgggcggcgcgatttattcggctgccggt
gcaaacctctggcctgccgcgaccgccatcctgcgtcgcgaaacatcgggtaattatccg
gcggcactcgccattttgaagtcggtttatgagggccttctggtgcctttcgacaccggc
ctcaagattgaacagcgctatttcaccgaaatcctccagatgaccgaagcgggcatgatg
atccgctcgctcttcgtgtcgttgcaggagttgaacaagggtgcgcgccgtccggttgac
gaaaagccgaccaggctcaagaagatcggcgtcatcggcgcgggcttcatgggtgcaggc
attgcctatgtgacggcgaaggccggtattccggtcgtgctgatcgaccgcgatcaggaa
tctgccgacaagggcaaggcccacacggcagacctaatcaccaaggaaatgcagaagggc
catgccaccgaggccgacaaggaaaaacttctgtcgctcatcacagcaacgccggattat
gcccagcttgaaggtgctgatctggtgattgaagccgtgttcgaggaccgcgaagtcaag
cgcgttgcgaccgagaaggccgaggaagtgctgaaatcttccgcagtcttcgcctccaac
acctcgaccctgccgatcaccggtcttgccaaagtgtcgaagcgtccgaagaattttatc
ggcatccacttcttctcgcctgtcgacaagatgatgctggtggaagtgatcctcggcaag
aagacctctgacaaggcattggccgtagcactcgattatgtccgtgcgatcaagaagacg
ccgatcgtcgtcaacgatacgcgcggcttctacgtcaaccgttgcgtgctgcgctatatg
tcggaagcctacaacatgcttgttgaaggcgtcccggcggcgatgatcgaaaatgccgcc
cgcatggccggtatgccggtcggcccgcttgcgctcaacgacgaaacggccatcgacctg
tcgcagaagatcctgaaagccacgcttgccgatcttggtccgaaggccgttgacccgcgc
catgtggaattggtggacaagcttgtcaacgagttcgaccgcaagggccgcaagaatggc
aagggcttctacgattatccggcaaagcctgccaagaagcatttgtggccgggtctgaaa
gacctctatccgcagcagaacccggacaagatcgatgtgaaggagcttaaagagcgcttc
ctcgtcaccatcgctctggaagctgcccgcgtgatggaagaaggcattgtgaccgatccg
cgtgaagccgatgtcggctccatcctcgccttcggtttcgcgccttatacgggcggcacg
ctctcctatatcgacggtatgggcgcgaagaaattcgtccagctcgccaaggatttgcag
aagaaatatggcgcacagttcaaggcgccgaagcttctgctcgatatggccgagaacggc
gaaaccttctaccagcgtttcaatccctataagggcgaaacgaaaaaagcagcctga

DBGET integrated database retrieval system