KEGG   Bacillus simplex: UP17_04525Help
Entry
UP17_04525        CDS       T04304                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bsj  Bacillus simplex
Pathway
bsj00030  Pentose phosphate pathway
bsj01100  Metabolic pathways
bsj01120  Microbial metabolism in diverse environments
bsj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    UP17_04525
Enzymes [BR:bsj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     UP17_04525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C Polysacc_synt_2 Epimerase DUF4552
Motif
Other DBs
NCBI-ProteinID: AMM91905
UniProt: A0A127D464
Position
971502..972287
Genome map
AA seq 261 aa AA seqDB search
MYTDLEGKVVVITGSSTGLGKAMAIRFVQEKAKVVVNYRTKSEEADSVLEEIKNNGGEAI
AVKCDVTVEEDMINIVRSAVKEFGKLDIFINNAGVENAVPSHEMPLSDWNRVIDTNLTGN
FLGCREAIKYFVENNLKGNVINMSSVHEMIPWPLFVHYAASKGGVKLLTETLALEYAPKG
IRVNSIGPGAIATPINADKLEDPEKKKDLESMIPMGYIGKPEEIAAVAVWLASSESSYVT
GITLFADGGMTKYPSFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtatacagatttagagggtaaggtcgttgttataaccggttcatccactggtttagga
aaggcgatggccattcgctttgttcaggaaaaggcaaaggtcgtggttaattatcgcact
aaatcagaggaagcggacagtgtattggaagaaatcaaaaacaatggtggggaagctatt
gcagtgaaatgtgatgtcacggttgaagaagatatgattaacattgttcgatctgcggta
aaggaattcgggaaacttgatatattcattaataatgcaggagtagaaaatgccgttcca
tctcacgagatgccgttaagcgactggaatagggtaatcgacaccaatttaacaggtaat
ttcttaggctgccgtgaagcgatcaagtattttgtcgagaacaatcttaaagggaatgtg
ataaacatgtccagtgtacatgagatgattccctggcctttattcgtacattacgcggca
agcaagggcggtgtgaagttgcttacggaaaccctggcgcttgaatatgcaccgaaaggg
attcgtgtgaacagcattggacctggagccatcgccacgccaattaatgccgacaaactt
gaagatcccgaaaagaaaaaggatctggaaagcatgattccaatggggtatatcggaaag
cctgaggagattgccgcggttgccgtatggctggcatcttcagaatccagttatgtaacg
ggcatcactttatttgctgatggcgggatgacgaaatatccttcattccaagctggaaga
ggatga

DBGET integrated database retrieval system