KEGG   Bacillus simplex: UP17_06450Help
Entry
UP17_06450        CDS       T04304                                 

Definition
(GenBank) TENA/THI-4 family protein
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bsj  Bacillus simplex
Pathway
bsj00730  Thiamine metabolism
bsj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    UP17_06450
Enzymes [BR:bsj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     UP17_06450
Transcription factors [BR:bsj03000]
 Prokaryotic type
  Other transcription factors
   Others
    UP17_06450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AMM92222
UniProt: A0A127D542
Position
complement(1367994..1368683)
Genome map
AA seq 229 aa AA seqDB search
MENTKLETFSERLHGRAKEIWKRNHSHPFVQAIGNGTLPEKKFSYYLKQDYIYLMEYSKL
FALGVIKAHNIETMAKFSSILNETLQVEMDIHRQYASEFGISTKELEETEPTPTTLAYTG
YMLNAAQHGTLADLIACLLPCAWDYYEIGLILKKQNGEALENNRYADWIRSYSSPEFGEA
HKWLIALLEELTRGMPEKELLRLEKHFLVTSRYEYLFWDMVQNEQDWPL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggagaacactaaattagaaaccttcagtgaaagacttcatggacgggcaaaagaaatt
tggaaaaggaaccattcacatccctttgtccaggcaattggaaacggcacgcttcctgaa
aagaaattttcttattatttgaagcaggactatatctatctcatggaatattccaagctt
tttgctctaggtgtcatcaaagctcataatatcgaaactatggcaaaattttccagtatt
ttaaacgaaactcttcaagtggaaatggatatccatcggcaatatgcttcggaattcgga
atcagtaccaaggaattggaagaaacagaacctacgcctaccactttagcctacacgggt
tacatgctaaatgcagctcagcatgggactttggcagacctcatcgcttgtctcctacca
tgtgcttgggattattatgaaatcggtttgatattaaaaaaacaaaatggtgaagcattg
gaaaacaaccgctacgcagattggataaggtcctattcatctcctgaattcggtgaggca
cacaagtggctgattgctttattggaggaattaacaagaggcatgcctgaaaaggaactt
ctgagattagaaaagcactttttggtgacttcccgatatgaatatttattctgggatatg
gttcaaaatgaacaggattggccactgtag

DBGET integrated database retrieval system