KEGG   Bacillus simplex: UP17_06965Help
Entry
UP17_06965        CDS       T04304                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsj  Bacillus simplex
Pathway
bsj00010  Glycolysis / Gluconeogenesis
bsj00020  Citrate cycle (TCA cycle)
bsj00620  Pyruvate metabolism
bsj01100  Metabolic pathways
bsj01110  Biosynthesis of secondary metabolites
bsj01120  Microbial metabolism in diverse environments
bsj01130  Biosynthesis of antibiotics
bsj01200  Carbon metabolism
Module
bsj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UP17_06965
   00020 Citrate cycle (TCA cycle)
    UP17_06965
   00620 Pyruvate metabolism
    UP17_06965
Enzymes [BR:bsj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     UP17_06965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_2 RnfC_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AMM92306
UniProt: A0A127D5A2
Position
1479725..1481083
Genome map
AA seq 452 aa AA seqDB search
MAFQFRLPDIGEGIHEGEIVKWFVKPGDKIQEDDVLCEVQNDKAVVEIPSPVEGTVEEIL
VQEGTVAVVGDVLVTFDAPGYEDLQFKGDHGEEAKAEGAKNTEAQVQATAEAGQEVKKEA
APVQENSAETGAGSQPQVEADPSRRIIAMPSVRKYAREQGVNIREISGSGDNGRIMKDDI
DAFKNGKTAPQQPAAQSEASQQTDTEKTEKQKVSIPEGQYPETREKMSGMRKAIAKAMVK
SKQTAPHVTLMDEIDVTLLVAHRKKFKGIAAEKGIKLTFLPYVVKALTSALREFPMLNTS
FDDEASEIIHKHYYNIGIAADTDKGLLVPVVKDADRKSTFAISQEINELATKARDGKLAP
NEMKGASCSITNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIIAAPVLALSLS
FDHRMIDGATAQHALNHIKKLLNDPELLLMEA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtggcattccaatttagactccctgatatcggagaaggtatacacgaaggtgaaatagtg
aaatggtttgtaaaaccaggagataagattcaagaagatgacgtgctttgcgaggttcaa
aacgataaggccgttgttgaaatcccatcaccagtggaaggtaccgttgaagaaatcctt
gttcaagaaggaacggttgccgttgtaggtgatgtacttgtaacattcgatgctccagga
tatgaagatcttcagtttaaaggggatcatggagaagaagcgaaggcagaaggtgctaag
aatacggaggcccaggttcaagctacagctgaagctggacaggaagtcaagaaagaggct
gctccggttcaagaaaatagtgcagaaacgggcgcgggatcacaaccacaagttgaggcg
gatccttcacgtcgtattatcgccatgccttctgttagaaaatatgcacgcgaacaaggg
gtaaatattcgtgagatttctggttctggggataacggccgcatcatgaaagatgacatc
gatgctttcaaaaacggcaaaacggctccacagcaaccagcagctcaaagtgaagcttca
caacaaactgatacggaaaaaaccgaaaaacaaaaagtttcaattccagaagggcaatat
cctgaaactcgcgagaaaatgagcggtatgagaaaagcgatcgccaaagcaatggttaaa
tccaaacaaacagctccacatgtaacattaatggatgaaatcgatgtgacgctattggtt
gctcaccgtaaaaaattcaagggaattgctgcagaaaaaggaatcaagcttactttccta
ccttatgttgttaaagcgttaacaagtgcattgcgtgaattccctatgctaaacacatca
tttgatgatgaggctagtgagattatccataaacactattacaatatcggaattgcagca
gacacagacaaaggactgctcgttccagttgtaaaagatgcagatcgtaaatcaactttt
gctatttcacaagaaattaatgaattagcgacgaaagcccgtgacggcaaattggctcct
aacgaaatgaaaggtgcttcttgctccattacgaatatcggttccgcaggcggtcaatgg
ttcacacctgtaatcaatcatccagaagttgccattctagggattggacgcattgccgaa
aaagcaattgtacgcgacggggaaattatcgccgctccagttctggcattatcactgagc
tttgatcaccgcatgattgatggggctactgctcagcatgcattgaatcatatcaaaaag
ttattgaacgacccagaattattgttaatggaggcgtaa

DBGET integrated database retrieval system