KEGG   Bacillus simplex: UP17_09130Help
Entry
UP17_09130        CDS       T04304                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bsj  Bacillus simplex
Pathway
bsj00010  Glycolysis / Gluconeogenesis
bsj00071  Fatty acid degradation
bsj00350  Tyrosine metabolism
bsj00625  Chloroalkane and chloroalkene degradation
bsj00626  Naphthalene degradation
bsj01100  Metabolic pathways
bsj01110  Biosynthesis of secondary metabolites
bsj01120  Microbial metabolism in diverse environments
bsj01130  Biosynthesis of antibiotics
bsj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UP17_09130
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UP17_09130
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    UP17_09130
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UP17_09130
   00626 Naphthalene degradation
    UP17_09130
Enzymes [BR:bsj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UP17_09130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PFK Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AMM92675
UniProt: A0A127D6E5
Position
1934436..1935614
Genome map
AA seq 392 aa AA seqDB search
MIWDFNFNLPTSIEFGNGKVKNIGKRAKELGGKKALLITDKGLAQTGILQKVTDSLDQES
VNYIVFDEITPNPKDVDCHRAYQQFKDEEIDLLIGLGGGSSMDTAKAIGTLLTHGGELRD
RYGLNLLEREITPLICIPTTSGTGSEVTTGSVITDTVTKQKEAILDIKLAPKLAILDPEL
TLTLPKSITAATGMDALTHAIEAYTSNIAEPISDALSLYAIELIAKYLPLAVENGTDLEA
RKNMLVASLIAGMAFDNADLGAVHAMAEPLGGLYDTPHGVANSIFLPHVFEFNIPSNLEK
HAIVAEKLGANKEGKTIEETAYDGVVLLKELARKIGIPDFRDLSNVNPQDFLFLAEGASV
HLCTQANSRKVTPADYLELFQKTYEAKNTTLI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgatctgggattttaatttcaatctacctacatctatagagttcgggaacggaaaagtt
aaaaatattgggaaaagagcaaaagagctaggaggaaaaaaggcacttcttattaccgat
aaaggactggcgcaaactggaattttacaaaaggttaccgattcgttagaccaagaaagt
gtcaattatattgtttttgatgaaattactcctaatccaaaagatgtagattgccataga
gcctatcaacaatttaaagacgaggaaatagatcttttgataggtcttggcggcggaagt
tcgatggatacagcaaaagcaattggtacacttttaacccatggaggagagcttagggac
cgttacggtttaaatttactagagcgagaaataactccccttatttgtatccctacaact
tcaggtaccggaagtgaggttacaacaggttctgtcattacagatacagttacaaaacag
aaagaggctatacttgacattaaattggctccaaaactagcaattttggaccctgaatta
actctaactctgcctaaatctattactgctgctaccggaatggatgcacttacacatgct
atcgaagcttataccagcaatattgctgaacccatttccgatgctctcagcctttatgca
attgaattaattgctaagtaccttccgttagctgtagaaaatgggaccgacttagaggca
aggaaaaatatgcttgtagccagtttaattgcaggtatggcatttgataacgcggatctt
ggtgctgtacatgctatggctgaaccactcggcggtctttatgatactccacatggggta
gcgaattctatctttcttcctcatgtttttgaatttaatattccttcaaacctggaaaag
catgcaattgtagctgaaaaacttggagcaaataaagaagggaaaacaatagaagaaact
gcctatgatggtgttgttttgttaaaagagcttgcacgtaaaattggtattcctgatttt
cgagatttaagtaatgtcaatccccaagatttcctattcctcgctgaaggggcatccgtt
catttgtgtacacaggctaattcacgaaaagtgacacctgcagattatttggaattattt
caaaagacttatgaggcgaaaaacacaacattaatttaa

DBGET integrated database retrieval system